SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0073018 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073018
Domain Number 1 Region: 303-382
Classification Level Classification E-value
Superfamily TPR-like 0.0000235
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0073018
Domain Number - Region: 212-284
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0745
Family MW0975(SA0943)-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073018   Gene: FBgn0041147   Transcript: FBtr0073160
Sequence length 777
Comment type=protein; loc=3L:join(3905357..3905539,3905602..3907752); ID=FBpp0073018; name=ida-PA; parent=FBgn0041147,FBtr0073160; dbxref=GB_protein:AAF47808.1,FlyBase:FBpp0073018,FlyBase_Annotation_IDs:CG10850-PA,GB_protein:AAF47808.2,REFSEQ:NP_647837,GB_protein:AAF47808,FlyMine:FBpp0073018,modMine:FBpp0073018; MD5=aeb196508772e4fd33aab77286efaa67; length=777; release=r5.30; species=Dmel;
Sequence
MILCLHFAGKSKIGFRGPKLTMNLFEELDTLDPSFKLEPPRIETPTAHKITVLILLKQYV
INKKNCLDTGISMRTQRRRMFYMLVFKLIQEQDKSYNELHSLLTTGKYKLDTLMLESFEK
AMSEFCAGSIEALFDFSEIQNIDEILNENYGISQFSMVGVYVRRVGVVLERLSFPEMMDM
YKNVCSYYERGVRAAASGSRMAVAGGILHREETPPPNPITEKPEDPKPKKKVEAVARIAQ
ERNPLSKWAPKQAKFFINKQSELLENNERKALPPLELQKKVQEIIHDLPLTTTPYFLGYM
NQLRVRDYYNALSALHRALDRSPVRLMSQEKGYQYFCVNLAVLHATFGHRDEALAALRES
IMLAQEHGDKRSLNLANTWYCLLRDELPLSAVQKSVQDANEVDGSLLQNYTLALHFAVKL
GTVAGYQPLRLFDLLQHSDNLTNRNNFADHASEALALRSAVWSAYGRHELAALYSQVLLT
GRDRFGSGSAGLGSALASFALWLQLQGEPQLSKVLLHHAKQRFPRLPSAEGWMISQCHVV
IQAGIYQCRWHDALKACDQLYLIDPSDSLFQRASIYVAKREFFNARRLLDKLAVQDNIPF
LLRMRVQVLLGYCGMANGRFSSETTMLLLRVSEEMSEAQMDYELALVDLLLALQLLLLGM
PQKAYQAIKRCMHDIHINGGLYERAKTDFVFVRCLLAVNQNDAEKRKAQLLKSQVILQRA
AQSFKKLSAHAKVLDVYVFLAQRFNEFGDRNLRNKYAGEFRRYFTDHPIPREYLGSP
Download sequence
Identical sequences Q9VZL2
FBpp0089265 7227.FBpp0073018 FBpp0073018 NP_647837.2.81976 FBpp0073018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]