SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0086747 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0086747
Domain Number 1 Region: 219-327
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-30
Family Calponin-homology domain, CH-domain 0.0000275
Further Details:      
 
Domain Number 2 Region: 7475-7634
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-30
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 6499-6658
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 7364-7523
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-26
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 5 Region: 3674-3851
Classification Level Classification E-value
Superfamily Plakin repeat 1.4e-26
Family Plakin repeat 0.008
Further Details:      
 
Domain Number 6 Region: 4266-4406
Classification Level Classification E-value
Superfamily Plakin repeat 4.97e-26
Family Plakin repeat 0.0081
Further Details:      
 
Domain Number 7 Region: 1498-1561,1629-1741
Classification Level Classification E-value
Superfamily Plakin repeat 7.15e-25
Family Plakin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 338-455
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 1954-2108,2162-2213
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-23
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 4754-4948
Classification Level Classification E-value
Superfamily Plakin repeat 5.49e-23
Family Plakin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 4112-4257
Classification Level Classification E-value
Superfamily Plakin repeat 1.19e-22
Family Plakin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 2304-2372,2401-2482
Classification Level Classification E-value
Superfamily Plakin repeat 1.57e-22
Family Plakin repeat 0.0062
Further Details:      
 
Domain Number 13 Region: 7271-7413
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 14 Region: 7034-7193
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-22
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 15 Region: 8451-8526
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 16 Region: 6085-6218
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-21
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 17 Region: 7714-7853
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 6610-6763
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 19 Region: 5761-5897
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-21
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 20 Region: 2502-2735
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-20
Family Plakin repeat 0.0055
Further Details:      
 
Domain Number 21 Region: 1730-1887
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-20
Family Plakin repeat 0.0037
Further Details:      
 
Domain Number 22 Region: 7918-8039
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 23 Region: 3866-4037
Classification Level Classification E-value
Superfamily Plakin repeat 9.59e-20
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 24 Region: 4493-4612
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-19
Family Plakin repeat 0.0056
Further Details:      
 
Domain Number 25 Region: 745-866
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 26 Region: 5266-5411
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 27 Region: 7599-7708
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-17
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 28 Region: 6721-6866
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 29 Region: 8069-8182
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 6924-7051
Classification Level Classification E-value
Superfamily Spectrin repeat 3.7e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 31 Region: 8136-8258,8310-8340
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000109
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 32 Region: 656-790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000256
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 33 Region: 5466-5589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000334
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 4016-4114
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000000458
Family Plakin repeat 0.0048
Further Details:      
 
Domain Number 35 Region: 8360-8470
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000182
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 36 Region: 6012-6113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000034
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 37 Region: 6279-6436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000662
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 38 Region: 5654-5788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000448
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 39 Region: 1225-1326,1360-1384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000636
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 40 Region: 5153-5261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000202
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 41 Region: 5021-5144
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000245
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 42 Region: 7163-7266
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000045
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 43 Region: 5867-5989
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000119
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 44 Region: 4638-4727
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000353
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 4947-5052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000878
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 46 Region: 1153-1255
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000158
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 47 Region: 594-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000051
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 48 Region: 4426-4527
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000693
Family Plakin repeat 0.0084
Further Details:      
 
Domain Number 49 Region: 994-1143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000561
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 50 Region: 426-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000777
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0086747
Domain Number - Region: 872-926
Classification Level Classification E-value
Superfamily SH3-domain 0.000391
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0086747   Gene: FBgn0013733   Transcript: FBtr0087621
Sequence length 8805
Comment type=protein; loc=2R:complement(9752859..9753000,9753566..9753631,9753954..9754137,9754207..9754480,9755661..9755854,9757365..9757482,9757548..9757777,9757843..9757960,9758027..9758201,9758345..9758416,9758799..9758843,9759484..9759658,9759714..9761673,9761739..9761964,9762364..9769841,9769906..9770052,9771600..9782097,9782344..9782474,9786955..9787176,9787871..9787954,9788942..9789077,9789192..9789822,9790159..9791077,9791319..9791687,9791753..9792666,9792727..9793006,9795094..9795723); ID=FBpp0086747; name=shot-PH; parent=FBgn0013733,FBtr0087621; dbxref=FlyBase_Annotation_IDs:CG18076-PH,FlyBase:FBpp0086747,GB_protein:AAF58320,REFSEQ:NP_725339,FlyMine:FBpp0086747,modMine:FBpp0086747; MD5=749b09af5b9cf3352f7124c63489e5a7; length=8805; release=r5.30; species=Dmel;
Sequence
MHSSSQSTLKRTQQLVRQTNGGRGDVLSSGSEVVHSSRGPAITTNIDDSNLRYRHETKRE
RTVEAVITDYPGVSPLGSVPHERTNFERTVTFQDPTGNSRRLSETGALVPAGAIPTSSTH
YQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENAQPAEDLL
PPAKMIRSSELEYRRALPPAIESSSTQRREISDIVVGKEDNVSAREALLRWARRSTARYP
GVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLL
DPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCRE
KTAYLQERSFPPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVD
VEAELRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLE
GRIGEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKK
VNKLHQRWAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEH
IEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELA
LYQQRLNQLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQ
LDLPSVHRYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLL
QLTLCLEVHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQD
LREELNAFGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTL
LDNSGRVKWRVRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRL
RQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREM
DEVNRLFDEFEKRARAEEESKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSL
EHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHK
DRLKLLEASLAGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQ
MDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMK
NLQSSVQVEESWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREA
KIYDSKCLRFVDWLVEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKNDRLLEQLS
QRLKTAIEVNGSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQI
SSTKTTKSSTKSVYSSDGLDAASQEVSTAGLPQSQIQFNEIRTLKRSQQLGGHSVLDIAG
IRDPRTGRVLTIGEAIQLRILDVRTGEMLVGDRRITLEQAADQGLIDLQLAKQLLEPGAG
RDASGRELSLLEVIQREISEAESGYETAEKRIKVNNTVTVEQTSGELGSPENPRNIADAI
TAGSVDTKTGLYRVKSGQTISLAEAYERGYLIRHESVTIKSNALCLSDAIAHGLVDGAGW
IADRNSGDKFRLDSAIANQLIDASVREVVDAKRDTKITLQEALQSGVLNAKTGRYVNEVT
KEKLTFAEARNRQLIVKPYTLKDICDLNLLDKQAQITSPMRREKLSIMQAIEAGVLDGNL
LKCITKRKGELVTLQEAIADGIVLPAECKYRDFMTGELISIPEAVERGLISSVAQRSIFD
IDGFKDLRSNDYVSFNVALSRDLLRRKSTGFALETGRDSLVPLEVAVSEGLVRQEVYEMF
SRGIGVQNASGKELSVFDLVYHNLIDPKTGYLLDPKTGETVPLDTAIERKFITPEGALLL
SSLLNITLTTETVTRTINRYVTIRAGSQEPVDSVLLTFTEAVRQGFIDEERQLFKDPKTG
NIYSVQQALNYGLLVPDSNQTVPEPTNRKKTKSTITIVTKQIIPEAEPIKLNTQHTKYVE
KSVEIPISQELVKPHRVVSEFINLEKSSYIEQNVTERQIMELPPGGWRLKDAIEQRLFNP
DTGVFHVQGTDRLVNFEECINKQIINNLSLSVIDPNTGDKISVQSAFERDILDSYGNYTN
SRKQVQGMRSAIDESKIILETVPATRGANQKTILRITKVNNIPDVLEVSTPLKDAPPKFV
EVLTCQRELASPEPLQIAPGAIYDPSTALVIFTQTGETENIFDAARQGLVDEQLIKIVDP
TTKQPISVTEAIARSIYDPKTATILDSEGQPVDLITATKLGLLSVVGAPLVAAEGALRTV
RFVTDPRTGEQIPVEVAYERGIVSRDQLHRGRSFDSEPATVEDKVVVLQRMRKVILKPKD
ALRKGIIDEETCEILENTSNFTNPKGEVVNITEALNTGLIDGRRGQVIDPQNNRVLNLRQ
AVEQKIIDSEQTNHILMPLAKSLSVPRLADQGLIDPQTQTIVHPESGYPLSIHEAIVCEV
LDPHSKLHKPEKCTLEEAITKGIINADDSTFNYKNKTLNITEAIEAKLFDPSYDQQKSKV
EIPPVGMIFPVAVEKSLVEPSKRVVLHPSTKKALPIKQAIEENFIMSIPYSPKPDAIEVV
TAMEQDLIDVAAQTLTVPSTGERIPLRQAMENGVLVVKNLSDFVITQKPIPKTEIMETVR
AVHTVTTKTIELMQGYVLISNNEVQNVNTGEVCSLEEAKELGILREESTTRETKAAAGES
PESVGDVGTSGDQTVIVEERTQTVVVSSDTRKQEMQVVSTTQSTKDTSVPSVSEIETKGS
KEPSKTLQNVKDAAKLGALGVIAAPVLAGGAIVSGVKSLIKSVKSPTEDAKSTEKPKEPQ
TSFIEQERRKELQPQQVPSEVDNLLSETENFISSTTANFIANEKQQDKPDTLPQESNLPL
EVESTSTLTTTTVTTITTSSTTTETGNLEPVVVEDVSTTVKEDKVVVKPSTVPEDKTEVS
KITETITTVTSNETDTVPEKISQKSASEESAKKDPVVTKDTSSRPAETETSPKPVQKEPT
PDPAQNTEFPESIKKDPTPEPDYKETATEAAQITPKEASPAPTNKNEQSAEPTSKPEPMP
RTAKKEEISEIEPPFTAPLAPFVDQLAETKITEIKTEFKEPVTSSQTITTITTTVKTVDE
HPIVEEVDEVSKSEKIVDVEEPTVHQQEPIKVNETSDDSTRTEPTNEIVHEERVVTVEEP
TITETTVTTTTITTTTTSSSEETLPQENTATVKETPLNEPVPSSPAETKEIEQTTNDDQK
KPEEIVDTEKKTTEQKPVETIPTEPISTSETTTVTLTTKTTIVDEGKLHPPSDIEQIIQP
HSTSDKHQSLVDFIEQEKGTQPAEGGSNILQNVKDAAKLGALAIVGAPVLAGKALVDALT
TEKTLKPEHSTSQVVTETVEELPTEIITTSTATLVTKVTTTTTTTTTSTSEGTPDDEALD
VVKLPAELVESSVKREVPRTLAIGDAISQKLISPDECQVIVDGEQQSQTVSTLLKEEQLS
PLDEVQIIDDKLIVLQQVSYLVDADTELTPQNLYELNIYDPENQYFIDPSTGQKISFHTL
VFDMNVFNPETILVKNFSTGKYETLTAALERPLLDRHTGHMVDPKTGKKIPFFECVDRQW
IIRANPEEQKPSGIENVTIDTQTGQVVLDDGRVCSIVEAINSGKLDIQSISVRDPVSGEV
IPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGARKPISLEAAVRKGLYDP
ETGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKLDCAIEDDLVLPATGQIK
DNKNNTLVPFDVGVQQCLLKTDNVTWSLPELLQREYYTPSTGKVLNPVTGEEILLQQAIE
MGFVELETTLVKDVDHDKILPGKEAAKVGLLDTVRGTLSSPNISLDEAFVKGYLISTKKP
LSLVDCLLRGLYDPSTAKFTIDDKQLDLKAAIAQKLINPEELVLLDPKTESIISITEAIA
KGYLDPIEGYVINPYASTKLSLHEALENRILIPPKRKRSLPDAVYRGLYDPKTGQFSNTV
TREKLTTERAIRRGILDPDSTVVNVGSGQIIPFGVATETGIVDSKHGTVRDADDHPIDFK
EAFDRGILVEAKKPLRLIEAVVKNVYDEVDGHFVDPKSGEKLNFAEALNTNLLDEHSVQI
RDFKTGLYKQLNLTHAKDTGIIDAQNSKLLYNNQTMTLKHAFDIGILMDVNAPISIQRAI
HQGLFDDKTGKLSDPRTGRQITLLESMRSFVVNPHLPCYFDEQTEQMYTLSETCRNGIIN
RREGVFREPGSNSFVPLGEALSLGLIVDIENAGFGLYELLSMGFYETSTRKVLHPVTNRK
LNLNEACVEDVVSLSSSLVKHHETGKYLRLANAIKEQLVDDSRGCYNLGNEQLDLQAARA
RGLIVSNRRLLSLELVLRQQLYRPETGKFCDPTTGEYLDLIEAIHSGFIDPATTVFKNQL
TGKELPLTEAIENGDIDVSKGRVFDPKSKSAYNYDVALSRGILVTITRPLTDRNDVVRRQ
DSVELLNQTPVSVVISKPREMSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGLVD
TTKRTLVDPKALYFAFDPTLIVYVREPVTFDQAAESKCLDLQTGLLTYVPASVPGSATAA
PASDDSANDSLTVIETPKVYTLKEAASAGVVDPDSALVKDLAKAKLVRLPEAFRKGLMDA
NKANVLNTQTSKLCTLQEAYESGLICTPKRSFGLLEAITFNLYNPTNGCLVDPFQMHPDI
IRRRKFTLAEAIGSGLVDPSSTVVRDPSTGVIVPLTAAISSGLIDATEGRLTDANEPKNN
IDLVKAAEKGLLLPAEQRQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELR
NQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDRV
NDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVR
EFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQ
EVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIA
GDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLELPIADL
KNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERL
QEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKFEKLYE
KANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRD
KDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAE
QQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKI
NDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGF
GSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGL
AQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQVKDILRRKSDV
PGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERMLTVLGP
ISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEIKLKDIL
GKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDTLPTDGDHQENLRK
IENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLDTKK
AETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMA
REHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYS
QTSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLGET
FLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGR
CEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDAD
HLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSP
PGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRK
TLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQ
QEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERM
NERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKK
MLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAM
EVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDRLHDEILGKKPDFSD
LADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLAESRQGLRHLVLSYQ
DLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKH
ISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEA
ALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFD
SIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQE
HRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERL
GILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAE
HKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESS
QFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRA
ANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNS
VMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMC
GEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDK
FAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREP
LSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDP
QLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQ
LLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERF
MEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKK
IKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVST
HREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAR
EFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGT
MRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGE
LLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSG
NNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRY
AKNAPDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSI
IQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIP
PVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVFKGSRDQGLNARK
GSRITPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLL
NDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGI
LNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLV
MLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRA
KGRTNIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQG
PIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLT
PGGSRAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQRKPSTGSTASGTTPR
PARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIRR
NISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences A1Z9J3
FBpp0086747 NP_725339.1.81976 7227.FBpp0086747 FBpp0086747 FBpp0086747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]