SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0271730 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271730
Domain Number 1 Region: 23-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.34e-82
Family Calponin-homology domain, CH-domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 4060-4219
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-30
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 3949-4108
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-27
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 3084-3242
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-26
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 268-385
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 4277-4438
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-24
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 3855-3998
Classification Level Classification E-value
Superfamily Spectrin repeat 9.03e-23
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 5021-5096
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.96e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 9 Region: 2333-2482
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 10 Region: 2670-2803
Classification Level Classification E-value
Superfamily Spectrin repeat 9.6e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 11 Region: 3196-3345
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 4503-4625
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 3619-3766
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 14 Region: 675-796
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 1836-1996
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 3302-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 17 Region: 1394-1523
Classification Level Classification E-value
Superfamily Plakin repeat 8.24e-17
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 18 Region: 4654-4767
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 3509-3636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 4721-4843,4880-4910
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 21 Region: 586-717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000176
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 22 Region: 3771-3892
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000187
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 23 Region: 2051-2174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000227
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 24 Region: 4930-5040
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000108
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 25 Region: 2863-3021
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000162
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 26 Region: 2597-2698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000196
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 27 Region: 2239-2373
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 28 Region: 1155-1256,1290-1314
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000317
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 29 Region: 1739-1846
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 30 Region: 1606-1727
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 31 Region: 2452-2574
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 1526-1637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000448
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 33 Region: 1083-1185
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000806
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 34 Region: 524-618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000301
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 35 Region: 924-1073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000331
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 36 Region: 356-483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000489
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0271730
Domain Number - Region: 802-856
Classification Level Classification E-value
Superfamily SH3-domain 0.000135
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271730   Gene: FBgn0013733   Transcript: FBtr0273222
Sequence length 5375
Comment type=protein; loc=2R:complement(9752859..9753000,9753566..9753631,9753954..9754137,9754207..9754480,9755661..9755854,9757365..9757482,9757548..9757777,9757843..9757960,9758027..9758201,9758345..9758416,9759484..9759658,9759714..9761673,9761739..9761964,9762364..9769841,9769906..9770052,9781635..9782097,9782344..9782474,9786955..9787176,9787871..9787954,9788942..9789077,9789192..9789822,9790159..9791077,9791319..9791687,9791753..9792666,9792727..9793006,9804359..9804529,9804623..9804712,9805354..9805415,9821135..9821231); ID=FBpp0271730; name=shot-PI; parent=FBgn0013733,FBtr0273222; dbxref=FlyBase_Annotation_IDs:CG18076-PI,FlyBase:FBpp0271730,REFSEQ:NP_001137657,GB_protein:ACL83111,FlyMine:FBpp0271730,modMine:FBpp0271730; MD5=4f2c3b64e40fbd079c9fd1d3ec3d5ec3; length=5375; release=r5.30; species=Dmel;
Sequence
MMDRESLSEWAKDKPLSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLKKANRRVVD
LFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDI
VDGNPKLTLGLIWTIILHFQISDIVVGKEDNVSAREALLRWARRSTARYPGVRVNDFTSS
WRDGLAFSALVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEP
DEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERSF
PPTLIEMKRLLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVDVEAELRPDAI
EKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRI
ERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKKVNKLHQRWAQ
LRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQ
LLAADYGSDLPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELALYQQRLNQLQ
KVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQLDLPSVHRYY
ENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHL
KHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQDLREELNAFGE
TVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSGRVKWR
VRTAKGQEGPIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIR
VVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREMDEVNRLFDEF
EKRARAEEESKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIHSDY
ERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASL
AGLEDNEHVISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQ
LGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEE
SWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREAKIYDSKCLRF
VDWLVEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKNDRLLEQLSQRLKTAIEVN
GSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQISSTKTTKSST
KSVYSSDGLDAASQEVSTAGLPQSQIQFNEIRTLKRSQQLGGHSVLDIAGIRDPRTGRVL
TIGEAIQLRILDVRTGEMLVGDRRITLEQAADQGLIDLQLAKQLLEPGAGRDASGRELSL
LEVIQREISEAESGYETAEKRIKQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREK
IDELRNQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRS
RVDRVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQ
ADSVREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAE
SPIRQEVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRII
SEPIAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLEL
PIADLKNNYQQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASL
IKERLQEQIREHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKF
EKLYEKANKRGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMN
ELSRDKDQLAPQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLS
KQKAEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAP
TIDKINDIGAQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLST
GSSGFGSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYE
NLKGLAQFLERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQVKDILR
RKSDVPGAEQLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERML
TVLGPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEIK
LKDILGKWDDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDTLPTDGDHQ
ENLRKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKK
LDTKKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIY
REVMAREHEVIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEH
CKKYSQTSETFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTK
GLGETFLSSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLD
HSLGRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAA
GGDADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEI
EKLSPPGREIKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQI
STLRKTLGRLDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELD
QIRRQQEDFRNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWND
LKERMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQ
KFLKKMLLDRQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELD
LEEAMEVAKRFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDRLHDEILGKK
PDFSDLADVTAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLAESRQGLRHL
VLSYQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGA
ELMKHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWM
QSAEAALAPSEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRD
NRRFDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVR
AQLQEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQL
CSERLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLL
QSIAEHKPLLDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESA
LQESSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFS
AVQRAANDVIAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFW
KQLNSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSN
LMNMCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLT
KAEDKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAA
SIREPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKP
IPGDPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLN
NEWKQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATE
QLERFMEVYNELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSR
ASDKKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQ
KDVSTHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHG
YKEAREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQS
VYDGTMRTGKNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFS
DALGELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRD
LERSGNNPEVGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAE
HKLRYAKNAPDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIK
NWLSIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQL
PDEIPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRITPTRDT
PDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWTKWRDVWMLSWERQRLLNDHLLYLKDV
ERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFIDGILNTKFDTSGL
EMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKPANDSDKIHDEVKRLVMLCTCRQKFR
VFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPCRAKGRTNIELRE
QFILADGVSQSMAAFTPRRSTPNAAATASSSPHAHNGGSSNLPPYMSGQGPIIKVRERSV
RSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTGLTPGGSRAGSKP
NSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIPQRKPSTGSTASGTTPRPARLSVTTTT
TPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIRRNISGSSTPSG
MQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences B7YZG3
FBpp0271730 NP_001137657.1.81976 FBpp0271730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]