SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289328 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289328
Domain Number 1 Region: 53-259,300-486
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000129
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289328   Gene: FBgn0052201   Transcript: FBtr0300051
Sequence length 520
Comment type=protein; loc=3L:join(18602729..18602937,18602988..18603139,18603337..18603487,18603542..18603738,18603791..18604419,18604475..18604640,18604703..18604761); ID=FBpp0289328; name=CG32201-PB; parent=FBgn0052201,FBtr0300051; dbxref=FlyBase:FBpp0289328,FlyBase_Annotation_IDs:CG32201-PB,REFSEQ:NP_730346,GB_protein:AAN11679,FlyMine:FBpp0289328,modMine:FBpp0289328; MD5=4dfc6e7214ce57908072ecb6c86e27f5; length=520; release=r5.30; species=Dmel;
Sequence
MRKYHSLLPVLLGFAVLNSFVGCVEDIEEKERYSSSTVGLLKLLKVEEKFTDNLLNQVDQ
LGEKFEALRMYLSSVGYELHRSLNEKVQYVSNPINAFSLLRRTHEDLPKWHEYFKEAIGE
GNQSILVDLVKMVPNDVDMLSAMHGIQRIEKIYDLKIDDLAQGVLQGVQYNVQLTYRDLI
AMGNSMYQQSDYQTAAKWYRIACKRELENPEQLFIQILGDPSEHLHRQYIKSLFKYGSTT
SEPSKSIEEAFIMVQASQEELDNIMSDLNEPQNDVEVEKDLYQVKRSPSNCELGCRGLYR
QKTNLVCRYKSTANTFLRLAPLKLEEISLDPFMAMYHEVLYDSEIRELKGQSMNMVNGYA
SQRNGTEIRDTVVRYDWWSNTSLVRERINQRIIDMTGFNFLKDEKLQIANYGLGTYFQPH
FDYSSDGFETPNITTLGDRLASILFYASEVPQGGATVFPEINVTVFPQKGSMLYWFNLHD
DGKPDIRSLHSVCPVLNGDRWTLTKWVPMFPQMFSFPCKS
Download sequence
Identical sequences Q8IQS7
FBpp0289328 FBpp0289328 7227.FBpp0289328 FBpp0289328 NP_730346.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]