SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313674218|ref|YP_004052214.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|313674218|ref|YP_004052214.1|
Domain Number - Region: 102-155
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.000615
Family F1F0 ATP synthase subunit B, membrane domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313674218|ref|YP_004052214.1|
Sequence length 250
Comment diviva domain [Marivirga tractuosa DSM 4126]
Sequence
MKITPLEIRQKEFEKGFRGYDKDDVKAFLASLSQEWEREMDMQKELKLKLEAAEKEVEKL
RQVESSLYKTLKTAEDTGANVITQANRTAELHLKETQMKADKLLSDAQQRAKDIVEDANH
KAQTILEEMEDELKEVADGFKLLESHRDNVAEELKNLSTGLNDKVKKIEDRMQHVDIETH
LKRARKAVKKIQNADGYELEELKSKPIEHEAAKPPKAENTPKQEEPAKEKKEKKDDGGED
TSFFDEITAD
Download sequence
Identical sequences E4TVH4
gi|313674218|ref|YP_004052214.1| WP_013452257.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]