SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313674523|ref|YP_004052519.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313674523|ref|YP_004052519.1|
Domain Number 1 Region: 293-520
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-37
Family ABC transporter ATPase domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 71-289
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.97e-16
Family DNA repair protein MutS, domain III 0.01
Further Details:      
 
Domain Number 3 Region: 721-795
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000111
Family Smr domain 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|313674523|ref|YP_004052519.1|
Domain Number - Region: 573-624
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00484
Family F1F0 ATP synthase subunit B, membrane domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313674523|ref|YP_004052519.1|
Sequence length 798
Comment muts2 family protein [Marivirga tractuosa DSM 4126]
Sequence
MILPLDFEQRIGFDKVRDLISAECSSNLGQEIVEKMGYIRKFDKLEPLLLQTDEFLKIFH
SGEYFPSGNFIDVSHFIKRAKVNGAFLTEEEFFDLKLSLKTILDCISFFDEFEEEYPYLF
NLRKAVNLEPDLYKAIDAKIDERGSLRNNASSALQQIRSDIFRAQAQLRRQVEKIYKQAS
ANKYTPEDASITVRDGRIVIPVLAEYKRRVKGFIHDQSGTGQTVYIEPTEALELNNEVRE
LQYAERREIVKILTQLTALVKPELENLEKAYKFLAIVDFIRAKARFAQKIGAVFPQLENS
RIIEFRNAEHPLLKLSLAEQNKKVIPLSIQLKGDKRILIISGPNAGGKSVALKTVGLLQF
MLQCGLLIPVHPDSKCGIFANLFIDIGDQQSIENDLSTYSSHLQNMKNFLLNSNKQTLFL
IDEFGTGTEPRFGGAIAESILEELYSQKAFGVITTHYDNIKNFAVKNQNVINGAMKFDER
NLEPLYELEIGKPGSSFAIEVAEKMGIPPTILNKAKGKIGTERVNYDKLLNQLGKEKREL
EAKIKEIQKREEHLEKSAQDYDELNEFLKTQKKQIITEAKQEAKSIIKEANKRVEQAIRE
IKESQAEKERTKKARKQLSDYDQKMEPLVENKPAKSSKPVFKTAEGEIKVGDYVKIKGQD
TIGEVLSLGQKEAEIMLGELKSKIKLNRLERMSKTAIKKEKKKSFSGTSTGMIERSTNFK
HQIDVRGMRAEEAIQAVDRFIDDAMVLGYNEVSILHGRGDGILRKFIRDYLKQYNYVKSL
KNEHEERGGDGITLVGLS
Download sequence
Identical sequences E4TNF4
gi|313674523|ref|YP_004052519.1| WP_013452562.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]