SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313674790|ref|YP_004052786.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313674790|ref|YP_004052786.1|
Domain Number 1 Region: 111-224
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 6.15e-23
Family Band 7/SPFH domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|313674790|ref|YP_004052786.1|
Domain Number - Region: 216-260
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0706
Family F1F0 ATP synthase subunit B, membrane domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313674790|ref|YP_004052786.1|
Sequence length 329
Comment protease ftsh subunit hflk [Marivirga tractuosa DSM 4126]
Sequence
MAEFEFDGDKAKESFQKIVKNIRLIVVVVVVLAAVISTFFQVGAEEVGVVTRLGAYNRTL
ESGLNFKIPFVESVTKVPVERQQKQEFGFRTTSAGVQSTFSKRGAEGESLMLTGDLNLAD
VEWVVQYRIDNPYNFLFKVRNPEETLRDISESGMRQIVGDRTVNEVLTVGRAEIAGKLKV
LIQEISNDYELGIRVEQVVLQDVTPPEPVRGAFNAVNEAQQEKETLINQAKSEYNKVIPK
ARGQAEETIQKAEGYATERVNNSEGEVARFNELYTEYIKAPGVTKTRIYLETMQEVVPKL
GDKIITDEKGGNVLPLLNMATQSGKKINQ
Download sequence
Identical sequences E4TRE4
gi|313674790|ref|YP_004052786.1| WP_013452829.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]