SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313676241|ref|YP_004054237.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313676241|ref|YP_004054237.1|
Domain Number 1 Region: 393-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-28
Family ABC transporter ATPase domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 129-207
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000405
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313676241|ref|YP_004054237.1|
Sequence length 603
Comment DNA mismatch repair protein muts domain protein [Marivirga tractuosa DSM 4126]
Sequence
MTIADKSEFYSKKINLFKNEVEKYRKLTNRFGTFRVFYFLATIVLSVYFINERDGFATSL
VLIPFPLVFGWLVNRHKSKKRLLELGRNRILILNEEIDRLYLKLDSLPRGARFNETLHEY
APDMDIFGRHSVFSLVNRSALTFGQESLANWFKNPAKKEEILERQEAVEEIKHEFEWRLE
WWAESRLKEGKGEEEDLKGLFNFFSRSEEEKIKPVFKFIPFIAIAQLLIFFLLSLTGFLP
WSFVGLGFLINILLLIPIQKTIMRLQSETEQIAVHLEQHKNLFKMAEEKKVEAKLFKRLQ
NHFQNPNASQKINTLSKILNWMHSRAGMMYWVINPFLLIDYWVLNNVVNWKNQYGKSIQG
WFTAIGDWEAIMSMADFAFAHESYKNATISDSKCELRAQDLGHPLLPHDQRVCNDFNMTG
PGAVTLITGANMSGKSTFERSLGVNMILAQMGAVCCVESFELSPLQLFTSMRTQDNLEEN
TSSFYAELKRLKQLVDMTKVPQERPIFYLLDEILKGTNSEDRNIGAESLIRQLMKTNSMG
LISTHDLSLAKLENELDNFQNYSFNSDVSGQEILFDYKLHNAPCHTFNAVPLMRKMGIEI
IAP
Download sequence
Identical sequences E4TV36
gi|313676241|ref|YP_004054237.1| WP_013454272.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]