SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313676659|ref|YP_004054655.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313676659|ref|YP_004054655.1|
Domain Number 1 Region: 69-126
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00000000667
Family F1F0 ATP synthase subunit B, membrane domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313676659|ref|YP_004054655.1|
Sequence length 166
Comment ATP synthase f0 subcomplex b subunit [Marivirga tractuosa DSM 4126]
Sequence
MEQLVNDFSPGLFFMQLFIFGVLLLLLSKFAWKPILNSLKAREGSIADALQSAENAKEEM
AKLQADNQKLLQEARLERDKLLKEATDIANKIKEEAKSDAAKQADKMISDAKNVIEVEKN
AALKEVTTKVAELSLEIAEKLIRKNLSDDKAQKALAEDFMKDLKLN
Download sequence
Identical sequences E4TNY3
gi|313676659|ref|YP_004054655.1| WP_013454690.1.33346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]