SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313677076|ref|YP_004055072.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313677076|ref|YP_004055072.1|
Domain Number 1 Region: 124-281
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.19e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 18-123
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.0064
Further Details:      
 
Domain Number 3 Region: 400-556
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-23
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0018
Further Details:      
 
Domain Number 4 Region: 259-283,310-411
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.31e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313677076|ref|YP_004055072.1|
Sequence length 708
Comment ferredoxin--nitrite reductase [Marivirga tractuosa DSM 4126]
Sequence
MTQVTENLALPKPAKKDIAELKNKIELFRSGQIDEEKFKAYRLTRGVYGQRQQGVQMFRL
KIPAGRITTDQLRVVADLSNQYATGNLHLTTRQNIQFHYVKLDDSPAIWTALEASGLTAR
EACGNTVRNITASHKAGIDPHEPFDVTPYLDAVFRFFLRNPICQEMGRKIKIAFSSSEKD
TAFAFIHDFGFIPVLRKNGKEEEKGFRVLVGGGLGAQTILAQEFFEFLPENRLITFLEAA
LRVFDRFGEREKRMKARLKFLIKKIGLDEFRRLVEEEEKVLHPKPLDLKPSKVKEAKPQK
IYSSYDVQDQWAYQQWLDSNVFEQKQQGYFGVLVKAPLGDIDHETAKKLADIIDEYVGGD
LVISVYQGLVIRFVRKNALPVLFEKLGELGLNQSGAESFADITACPGTDTCNLGVTNSTA
LADVLEKFLLQEFPHLAHSKLIDTKISGCMNACGQHMIAGIGLHGSSIKNKGKVVPAMQV
VLGGGLRADGTGLAAEKVIKLPTKRIPEAFRILLNDYEANAKGAFYPDYFRTKEKKYFYD
LLKHLGDLTDIKDEDYIDWNRDQEFTPEIGLGECAGASFDLVSTIFKEAEEKLVNAYEQL
QEDQLEHALYNSYNVLVTTAKALLLAEDVQCNTQAGIIADFDVHFVETEKVKLESSFADL
VYQIKLQKPSEEFVQHYLKSAHQFLEEAKSLRGIASTEKTVINHFYKA
Download sequence
Identical sequences E4TTG1
WP_013455107.1.33346 gi|313677076|ref|YP_004055072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]