SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313677791|ref|YP_004055787.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313677791|ref|YP_004055787.1|
Domain Number 1 Region: 96-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000353
Family NfeD domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313677791|ref|YP_004055787.1|
Sequence length 153
Comment hypothetical protein Ftrac_3712 [Marivirga tractuosa DSM 4126]
Sequence
MVGIIFLILAGLLLIIAELIFVPGTTFVGVIGLLLTIVGIFIVFDDYGNTAGYWTTAGTA
AVTIIGIVYSFKSKSWDRFSLKSSIQSKVNDEDIFTFQVGEKGKTVSDLKPIGKAEIFGK
IYEVRSKGEWIGAGQEVEIIKIDSKRIFVEPIK
Download sequence
Identical sequences E4TQI6
WP_013455821.1.33346 gi|313677791|ref|YP_004055787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]