SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313677337|ref|YP_004055333.1| from Marivirga tractuosa DSM 4126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313677337|ref|YP_004055333.1|
Domain Number 1 Region: 119-241
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.96e-23
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0063
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313677337|ref|YP_004055333.1|
Sequence length 249
Comment succinate dehydrogenase and fumarate reductase iron-sulfur protein [Marivirga tractuosa DSM 4126]
Sequence
MKFNLKIWRQKNNQDKGAFKTYELDGVSSDMSFLEMIDVLNEQLIDKDEDPVHFDHDCRE
GICGMCSMYINGEPHGPLRGVTTCQLHMRSFQDGETITIEPWRAKAFPIVKDLAVDRSAF
DRVIQAGGYVSVNTGGTPDANEIPIPKSVADEAFDAATCIGCGACVAACKNASAMLFVSA
KVSQLSMLPQGKVESAERAQKMVAQMDEEGFGACTNTGACSAECPKGIDLSNIARMNREY
LGAKIGSQD
Download sequence
Identical sequences E4TW07
WP_013455367.1.33346 gi|313677337|ref|YP_004055333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]