SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0273837 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0273837
Domain Number 1 Region: 268-392
Classification Level Classification E-value
Superfamily Plus3-like 3.79e-27
Family Plus3 0.00035
Further Details:      
 
Domain Number 2 Region: 103-152
Classification Level Classification E-value
Superfamily Insect cysteine-rich antifreeze protein 0.0000432
Family Insect cysteine-rich antifreeze protein 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0273837   Gene: FBgn0244640   Transcript: FBtr0275399
Sequence length 640
Comment type=protein; loc=Unknown_singleton_2641:join(5433..7299,7364..7419); ID=FBpp0273837; name=Dpse\GA23238-PA; parent=FBgn0244640,FBtr0275399; dbxref=FlyBase:FBpp0273837,FlyBase_Annotation_IDs:GA23238-PA,GB_protein:EDY71729,REFSEQ:XP_002136714,FlyMine:FBpp0273837; MD5=f47a591f35444218223c46b91e2b8d00; length=640; release=r2.13; species=Dpse;
Sequence
MSTEDLDGWDDFEAWLAMQDSKDDASNEDAADRERLQGISQQKEEEELEQHKEILPKADD
GSDESDIDVAEFNDPSQMTLEQLEKAQRIYLRRLKREESKEGTCLKQEECLEQAECLEQE
ECLEKEECLEQEECPEQEECLEQEECLEQEECLGQERFQMRRKNLKRQRAINDRTTALQR
LHNERLQRLEKKSNAQRQKDRICKWMEDDRRDRAKLSNKDRRLPQVSKVRLRASDIYSDN
SSDSSSPNEADDNEKRQPMNASPTLLSSLDQLNSVMLKRSQLISFVDKPIFGQTVIDCFI
LMPNTNLRSTIYQITGLVHTDVTYQLGHKTTDYQLNVRHGRLERLTRLDAVSNSPVPNVA
FRNWIDNCEKDNWVLPELSLITKKEQDIKKATNYIFTEDDVADIVKKKRESGLSQEKVAV
RKIRLIEERDLALTNNDHEKVVRLDKEIKEIDQDQDQDKANFGQKVPRFGGSLRSGLTPY
VPKNPVQKSEQRREAALVPALSRCHKHTGPSDIPRPQVPPVTKTPHIPRLPQTATLRKGI
SAAPRRPRPLPTKRCFPESAPKPLDTGLERYIKRKYKKSALGKRSPEPVAEVPEVVAPQE
AKKDASLYDLHDFHVDVDTSVLAPFDSLFGKEESPDPALE
Download sequence
Identical sequences FBpp0273837 7237.FBpp0273837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]