SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0282088 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0282088
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000759
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00087
Further Details:      
 
Domain Number 2 Region: 51-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.000000000000366
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0282088   Gene: FBgn0247919   Transcript: FBtr0283650
Sequence length 129
Comment type=protein; loc=2:complement(13419261..13419578,13419663..13419734); ID=FBpp0282088; name=Dpse\GA26545-PA; parent=FBgn0247919,FBtr0283650; dbxref=FlyBase:FBpp0282088,FlyBase_Annotation_IDs:GA26545-PA,GB_protein:EDY68001,REFSEQ:XP_002137443,FlyMine:FBpp0282088; MD5=4766411428967b151ef00e96bc0e42ce; length=129; release=r2.13; species=Dpse;
Sequence
MAYQLYRSSTVGITLQDTLDELVKNGQMSPFLAGKVLQQYDVSINEAFKENVKTCLTFTG
SRLSSYQFCDNVWTLRLKDVEFCSKNHVIAKVDKVKIVACESDGEGGKQKTEGSMKKTNK
KKTNVNVVK
Download sequence
Identical sequences B5DYM1
7237.FBpp0282088 XP_002137443.1.19638 FBpp0282088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]