SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0283675 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0283675
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 6.93e-61
Family CutC-like 0.00000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0283675   Gene: FBgn0248499   Transcript: FBtr0285237
Sequence length 259
Comment type=protein; loc=2:9875696..9876475; ID=FBpp0283675; name=Dpse\GA27128-PA; parent=FBgn0248499,FBtr0285237; dbxref=FlyBase:FBpp0283675,FlyBase_Annotation_IDs:GA27128-PA,GB_protein:EDY67865,REFSEQ:XP_002137307,FlyMine:FBpp0283675; MD5=f84bdfc3ccfc8e0c248e1f4f55c3cf47; length=259; release=r2.13; species=Dpse;
Sequence
MSGHDIKLEVCVDSIGSAFAAEVGGASRIELCSALGEGGLTPTVGTLKTLKDSFTLPIFC
MLRPRRGTDFLYSEEEMQAILTDMALLREHGADGFVFGALNTDRTIDANKCRQVMQQSGG
LPVTFHRAFDLTHQKRMHEHVELLRELGFKRILSSGFRPSAAEGADCLAQLIAKHHRDII
IMPGAGIKVANLEEILTVSRCLEFHASAMDTAGEDYTAPTTTRMECDVTMGKQDIDPYYG
TNSNVVRKMVTIANAMSCR
Download sequence
Identical sequences 7237.FBpp0283675 FBpp0283675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]