SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0272255 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0272255
Domain Number 1 Region: 52-287
Classification Level Classification E-value
Superfamily L domain-like 1.8e-36
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 283-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000525
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0272255   Gene: FBgn0243744   Transcript: FBtr0273817
Sequence length 865
Comment type=protein; loc=XL_group3a:join(490827..492588,492665..493500); ID=FBpp0272255; name=Dpse\GA22337-PA; parent=FBgn0243744,FBtr0273817; dbxref=FlyBase:FBpp0272255,FlyBase_Annotation_IDs:GA22337-PA,GB_protein:EDY73142,REFSEQ:XP_002134515,FlyMine:FBpp0272255; MD5=593aa449873ed3aef03bd3da8268784f; length=865; release=r2.13; species=Dpse;
Sequence
MVISSSSLTSLRLRLPILLLLFKWVCLVSLLRLVPGPRPARGDWLMDCGNCHCKWNSGKK
TADCRNLSLSGVPEYLSSEVQVLDLSQNQILTLEENAFLATQLQNLHKLFIRNSTLQKII
PQSFTQLEILIELDLSNNLLRELLPNVFDCLTKVRALVLNGNLLQTLRGGVFHHLKYLHK
IELKHNRLVSIDPQAFLDVPLLSQIYLDGNQFRVLHRETFQSLNRLTALSLDQNPWNCTC
DLQEFRDFVLKMNLYTPPTACHYPLQLRSMLWIEDQPEAFACKPKIVYPARGASINTSKE
NVTLVCRVHGSPNTVVAWDYNKQLYKSGSTTGSMGSTGSMGPRHPRVHIEMLREEKRSTR
DPQFGRDVFTSRLTIVGAEKSDEGVYTCLAENAGGKDAVQMSLLVQKSSVQRDLLLNSNL
FVIICLMVLGLISVSVLLSMVTYCIYRRFKHLHLHPRQHTHLRSINFSAQQFSSDAGAVV
LHGHGVSNSVVVAGGTEVLLDTFQNQATDRHRSVEPIAESRKFSDLITSIDRNRSPHAIM
GYLCNRPSAIGGNNVASRNSNSLLSGEDDYGARKHRDETLTLERKFKDKLNVTSKGYDSN
RSNVIEDHRIMPSASASATATACDIRETAIIRQSEEYQPDVLPSNSPTEGPGRPGGLTML
ENNEDQLSQQLMLIGLNSNCNSNSNARSKYNINVQKYLQDKYGSVGTAVRRNNNNISDSR
QESASGSFLLYPPKVAQQQLHLQPQPQPQPQLQGLQRHCRSLALPSSQRQSTDSHCRQPS
PPPYTTNSATSTIPCTLSLSLSDAASRGGGGGGGGGGGGEGVMENMIAAITVTSSSSLAP
LQNKLTTTAVAASTNNGSASRKRIL
Download sequence
Identical sequences 7237.FBpp0272255 FBpp0272255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]