SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0280247 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0280247
Domain Number 1 Region: 668-761,830-1107
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.29e-79
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0061
Further Details:      
 
Domain Number 2 Region: 51-130,159-332
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-51
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0012
Further Details:      
 
Domain Number 3 Region: 335-676
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 4.18e-47
Family Lipovitellin-phosvitin complex, superhelical domain 0.00068
Further Details:      
 
Weak hits

Sequence:  FBpp0280247
Domain Number - Region: 4076-4192
Classification Level Classification E-value
Superfamily vWA-like 0.00474
Family Integrin A (or I) domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0280247   Gene: FBgn0074008   Transcript: FBtr0281809
Sequence length 4334
Comment type=protein; loc=4_group3:complement(516499..516552,516615..517305,517368..517568,517642..518207,518268..518503,518564..520832,520896..521520,521581..523280,523351..525310,525370..525728,525792..526002,526056..526399,526473..529282,529342..529501,529562..530301,530356..530434); ID=FBpp0280247; name=Dpse\GA13976-PA; parent=FBgn0074008,FBtr0281809; dbxref=FlyBase:FBpp0280247,FlyBase_Annotation_IDs:GA13976-PA,GB_protein:EAL33432,REFSEQ:XP_001356369,FlyMine:FBpp0280247; MD5=be6583d8ffa779d8082e2dada016acbd; length=4334; release=r2.13; species=Dpse;
Sequence
MGALYRLAAGLGLLLLIAAHCQAARKNPLKDPRICGRPQCEIENPKFSYGEKLYKYEYTV
SLRTEFAGSGDNSSDLVLKTNLDIFFPKPCEGYLRINDAKLYDRLEDVDNEPEKPKEPSY
DYYDSLTSAENVDEQQTGDFDNLHPQSVSLAIDLSKNLLRFAFHDGLIGEVCPQEQETPW
VLNIKKGILSAFQNTMMRFDVDFNTTETDVSGECQVQYALEATDNVYVTIRKTKDIASCR
QRYATHSVLQTTPYTFRDDKTIWPILNSQSYCNLTVDQRMYREISCVETHLLVPFSNASS
GALTTSRSRLLLKEEENYSAGEFLEQNPELVDRRATLVFDHTPAVKPSHDEIKAAREQLV
EMCALGFPNIQREFIDIFSSFLHTCKSLDYKTLSVLLQRSAGTCDQGRNHVLESLPYIGS
TASYQVMRDQIVGEKLPKQMAHSWMTSLSFITRPDEQTLETFYTILEYAKHRLDPEYTLG
ATAVVHSYCKHHEACEESLRVQQIINLLETEFLSRFQVYKGERKHRERLVVLLKGLGNIG
VISAAFAEQVQEIIRDDAVPVDLRLQGILAFRRVDCLKYRGYFLDRYANYTLNAELRIYS
YLQAMRCPDYISVGSIKAILDHEQINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELS
ERFKLDIRKFSRNYEHSLFFDEYNFGTTTDANLIFGTDSYLPRIASVNFTADLFGQSVNF
FEFSARAEGLEELVAGAFGPKGPFNGELLRKKLSFLNRWLGNESAEEEDTIENLLSLDSL
RLKRKAQLAAAAAGGAGTEEEDEDYDYEEALSGSKRQKRDAGAAASASARKDSIDRNVDK
LGYKLKYDYSNPRAQFGLRVFGNDLRYYNVESMMEVMALAAQFNPFEQANRVLSGKEFTY
TKSRVFLDASYTVPLAVGLPLAIHAFGASSVDLRVSGSLDQMEPPTDWHFDVQGRFKPSV
SVDIISTMQTDMFWGESGIKVKSNLYSNSELEASLKVRGRNLVSFSFNLPQDKNEIFSVR
SELLVMKRDQELPQAGIPKRSSNSTCTWPVLDSALGLQMCSHYSVADLSNATSAYPSLLL
AGPLNLSLILKKSDLSSKKYVFEYRWDQQEIDNFSLVFTTPGSKVPRVLVANVTSVPHAF
NASVAFVNGRNRVSAGCSYDGDPDYRRLDLYLDTNGNRSLDLGMELRRQQDFTAWIYKPR
MLLAINGVNITGLVGSIKINEKNGIRQHDVDLSFETKKLQAVVRGNIVQSEVTTSTNMTI
KYRFQANTIETINFAGRLMNNGDRAKTEYRGNMKLRTSAYPKLNFASNATWLSLQGHTEG
MITYNNAPDYVNPNYTSLLRLIFARSQSEDLLWEGSRTRASVELKLPRSKIDYRIMVKHE
ERSKNGTEHNVIVGLKYAPEKEVTGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVN
EKAPKEYMIFINGSWFTGHSIALKGNYKDRSSRVQALHHLKLIVESPSFEATSLNIVYRR
NQLLIFYDLQAKYGKDPYGLTVQYAANAHNRNSNAEVRFKIKERDYWINAKLLSEQPKLL
QLELHIDKIRDIHIKVGLLNVEKRKELSLELKWDANRDPSQRLGLLVEYNNPGTKHYDGN
MMVTYPERTINCGFNTFTGGPKYYGKAHASWSITEVIEFEYDAGILPGQTLHNWLHAELR
TPFEGWRTNSLRAGVYNLQNLILVNSTLFWSDDQKLELGYKSDYEISEQLVSFDVRFGIN
STIKDIPTLNVKVIHWQDPQKVDTDLYLRYSQNETFSTYGMNSNWEISRTQRHHNVSGRV
HLVSPFVGYQKGGLVAKFSLNDQRVVSGAASLNFDVREFTLTMDGYVKKFTDNMLTINIT
TPLEKFRTINGRFGLNEKKRHAVAEVRAPTAALGVEALADIKSLLTFDVKLSVATPIESF
QQAAVVAQMNPERVDMRGLWNNATLGFTGVWHMNNLTDFEYSYLVFTPLAGFEENGFIAQ
LLKRETFVFQLHGKLSSYRLGVKIRGEPKSELINQLGSHKMQLEMLYDEDFQPLNADTDY
KPDADEEYFSYFTSFEVDSLAWPTVVGTVDIQEIIDFYLIVGHVQLPQGRLEFKDRLHYP
DYLNVHNLLTVQTPFSAARDVKSIVEYHIDLNFNSFYERIKFRVNDVQNHIQELGFEVNY
TKVQDNVKPKAHHVQLKLTTPYELLQEIDIRGRLEVDDNAYKGNITSVTAHTHLSLAASV
ENEDSFLETAVGILLETDVIPHYACQAYFKKDFSAVDNSIDIRFEVTDNGTINKLHIETD
WHTDPQYFVNANGRIRTTMLPLQQASTSVLATKGASPQLSFDLQFQSRDGQSVAYGTRAN
KKKDVFNIEVWTPLKNYRNISMHGTFVRSPRDAQRYDVSGFLYRNMATYGITGAVRMGDG
LPIDATLRVQPKAGGRDGVIEVNINEAGPKKIRFSFSAIEDGKMCQISGGYSVSDDGMDF
SVLVESTEPEIARINFYGTLKPSTERGAMVADVNLETPWKQLGIESVHLHSDVGVHSDRG
KIVGEYQIGPYIGRGSCLWSWVLAENLQLVLESYLERPSAQPRKVHASARYLNPGKTFQQ
LQTGGRLSVDSKWNLDVNGSLRYASVDDFEFGILTQLPLPVGDRHQISACYRGNVISQQF
IDPHLFLEVSYEAVEAQKQLLSRLSYRNETSNLQGLAHVEWGAVKSPSVVEGDFQLLQKQ
GVRREFYAKVITPKFKEEHTVALTGHYDQKDREYHNLVCALDYPASRRISDLDVSFSSLT
NMHGTLNSTTPFLNVTWFKTDFEFTTKSGKSYRYCRCFWPQDSAYFKLQSTYNSSADNSN
HNLNGNVELEVPLTTRHRADIAYGLQKRQNTDSGNVKVVYNDQQVLDGKYKRNEQKKSPL
YKETTDITLENDVKPLGIHYVNTRDTSDPLGVRDIKHIEVYELRNAKNFNLTGELHTRIM
INGQDFKVVAIHPNRAVVLYTKYEEVSPEVVRQHTKLELSETAWIGYNLELGNFTTVGNE
SQSFALDIFYPKRNLTTAGQYYITDNHFNSDLSLQWGGGDIYQQPKTIRSNLHWTAEPLH
RGDRDHRTFGLSVAHPYLEKDINCRATYYRGAQDLLRTHLTIDYSEQPEQLIVLGAQLRD
LYSQLGHTNYTFKIYGKHQASELDVQLNGTLAARTSYYKTESTAHYKRDIFPARYGKFLA
LLDLNKRELEYERQSPFHAVRLHLLPTWQYPVYGLNATIWDTPDTNHTGYVFVDLAERYA
RMDFNLTEDASQNLQMVGYIPDSRSGYLDIWRNYDEIRVIDVSSYLKMNHSRLITGRFHW
RPSIRGELREKINSVGNSVYSSFSEGIDFWIKSIYTETVESVGVVWATAREYNKEFIEDI
GQLSVLEEDLNDLRLFMNKSYEANDFYIKHVVNFTLTILDELAIRDHIESLPKIFTELWQ
AMGDSGKALRNSIVWLIETIKATYNNLLEAVSRFFHGESLAYVSTLMEKSIEKYDKFVKE
LHIKFIKYIENLWHKTWTLAENHWKNVLKRFEPHMFKMISFIETTAWDLSKEVFDFIYKR
TNELAESPYFNKVSSFTADAERLYRDFKANDAITNIKKYSTLAWNFVKEKYFKLVPFGAE
LNEVLTEIWQELKELEKIEQVQIVVQKYNEIVAKIDWVADELQFEHRLHQVYGLLRNKFR
NYAMNALETADMYREAKTKFVFDPEVGIIDLEQKLPMSWHAFNETPKFEEIPEYQMLSKV
QSFFSETNSSIVMKLYNMRAHLDPKTWLPPYYSRALLIDSRHYMTFDQRYVGLNLDFDGS
ANPQCSYLLAHDFFKRNFTLLLEPSSQSQGLTRKLSFIANGQLIEIDLGTDHISVNGNPQ
PILPLKLGAVNIYRELDVLSITSDTQFSLHCNVQFDLCWFEVSGWYFAKTAGLLGTLNNE
PYDEYTMSNGVIANETQAQAFTDSWSVQQCRQTQASIRPAITKEVSETCSSFFRTGILST
CSAVLDPTPFYEMCLDLGMKSAPIRTGHPAVKGACAAALAYIEACTALKVPMRVPSQCVF
CQLANGSYVPEGTFMELTGADIPHSSDVVFIVEAKDCNANLNVSKNIMTVVGSIEEQLQV
AGLTNNRYSVVAFGGAAPYDRARSIIYEHNEFTSRPEQLSDYFGHINTGNGSSSDILMAI
STAAKLNFRPGVSKTFILLSCSRCAAKDMRFDYTSILQYMLEEGINLHILADTEFDFERS
RKLRHFFGMDRDLVYSKRFPEGDGETRKQVHIPKSNLGICTPLALETEGSVFSARKLQPE
RKYPIKRFATIFAKRVALSARPIQAQTCECSAHNTGVSYVACSPRALPEEKGRLDDYDDF
NDWEWDDELDAEAP
Download sequence
Identical sequences Q29NB0
XP_001356369.1.19638 7237.FBpp0280247 FBpp0280247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]