SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0281854 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0281854
Domain Number 1 Region: 37-271
Classification Level Classification E-value
Superfamily L domain-like 1.7e-37
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000327
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0281854
Domain Number - Region: 491-581
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00759
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 
Domain Number - Region: 656-750
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0523
Family beta-sandwich domain of Sec23/24 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0281854   Gene: FBgn0074800   Transcript: FBtr0283416
Sequence length 869
Comment type=protein; loc=2:complement(16628730..16631290,16631362..16631410); ID=FBpp0281854; name=Dpse\GA14773-PA; parent=FBgn0074800,FBtr0283416; dbxref=FlyBase:FBpp0281854,FlyBase_Annotation_IDs:GA14773-PA,GB_protein:EAL28141,REFSEQ:XP_001358998,FlyMine:FBpp0281854; MD5=2e623fa8018bfdf35bf2a3a1994cdcce; length=869; release=r2.13; species=Dpse;
Sequence
MDRRSRSTTTTTMGLPVWCLLVLCLVAWTGADDWSLSCASNCTCKWTNGKKSAICSSLQL
TSIPSTLSTELQVLVLNDNHIPYLNREEFSALGLLNLQRIYLKKSEVQYIHKESFRSLKI
LVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLIS
YIDPMSLANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRSWY
VASRLSSVSLVCKGPPAQKDRTWDSVDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLV
YGDPLPEVAWELNGKILDNDNVLFDTESIASDKLWSNLTVFNVTSLDAGTYACTGANPIG
SMTQNISIYLSEIVQHVLVKTPETFWYFGLIMGIFGTIFLLIAISFVVCLCKRTTRQHRH
ANKAGVKSSVSFNDQEKKLLDSSVTTTTNDRGDSYGIDNNPNSISINKAESAGLGFNQIE
IHAVENHRGGMGHGSMLVHQQQQHQQQQQQQQQQQQQHPHQHMRQQLMTVKDPTCGMITV
PTSMAGHTHTHTHPGQISEEFPLNVGVFPPPPEFCSNIVPNPAFGGNIFIRVSVTQDMLD
GADLNMYPDLLNIPKRMQDVQCNNDGGSGTVSVPEGQFATLPRHTTRRGILKKDTSLQQH
HQQQQQQQQQQQQQQLQQGATTGLYPHDEIVTYNLDASGYVDSHSHQTTYHCVAGGQSNA
MELPPPPPPPAVTAVVQCHHPNSSATSNMPPVSAASCASCINNGPPPSACQTPPIEVTPL
RPLCGKSGGGDSSAYPKYDNMGRRITASGGLGNSTLSLPDEEQYESETLFNENQPEKQSV
GGEQAQDHHQHQTETSQGQDKDRGEFVSL
Download sequence
Identical sequences FBpp0281854 7237.FBpp0281854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]