SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0284459 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0284459
Domain Number 1 Region: 1005-1113
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-24
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 257-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 375-469
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.42e-20
Family FHA domain 0.00042
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.05e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0284459   Gene: FBgn0075408   Transcript: FBtr0286021
Sequence length 2113
Comment type=protein; loc=2:join(21759937..21760041,21760102..21760210,21760282..21760475,21760554..21761072,21761977..21762058,21781224..21781576,21786223..21786344,21787588..21787642,21787709..21787989,21788349..21788558,21789776..21790241,21790323..21790847,21790913..21791160,21791222..21791340,21795323..21795598,21795750..21795999,21797343..21799455,21799514..21799635,21799697..21799889); ID=FBpp0284459; name=Dpse\GA15389-PA; parent=FBgn0075408,FBtr0286021; dbxref=FlyBase:FBpp0284459,FlyBase_Annotation_IDs:GA15389-PA,GB_protein:EAL28554,REFSEQ:XP_001359408,FlyMine:FBpp0284459; MD5=f0deaa2ef7f02624fd32fbfa6304fd9c; length=2113; release=r2.13; species=Dpse;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTANGSQLGL
GNGLGSGSNSSHMNGNAGGSGPDGSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKL
EKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKA
DPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPL
GAANGASHMSGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHC
LISLHEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGRYNL
ALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSEYDQHQQSNQSSGYHNNNNNSSE
HPLSSTLRGDVVDSKVTGQDQAANNATGLLGGTHTMAYDGQSLEGNLENETKSISSMKSS
GSNSQDRSPKMPGSGLLAGGGGSGSGDAQGQEPILPAVLEFPETHQELFLRHIISELDVN
VPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTDPR
ILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQFL
SENIDHDSAAGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQMC
TSDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACSCF
RLNSLQMGALLQQEKIPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLPDD
GFSCDVVRGIPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSAMSNKLPQ
PELQLIKLHKNSNGMGLSIVAAKGAGQERLGIYIKSVVPGGAADADGRLQAGDQLLRVDG
QSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRMSERDLT
RMGAAESSKSLGGIGGPLIATGHANHSLSLSQHLNNSHNMNSNSNSHNSNSNSSIINPLT
AHLPNSKSVPALHHHTGSGTISLANSKSRSTHSLHNNTSAAMGGIGGGVGPGPGPGVGAG
MLGQPNGSHNNANGNGNGNGNEQGFYQNLSVYRAQNQSQPILNERPPMSTHAAMNAYNGN
SPLAQQQQQPQQPQPSPYQQQQQQLLQSNANLPPTRPVSAYYHSQQTAQQQLQQQQQQQH
TLQQQQFAHSSSNLNGQQQQQQAQHQHQLTLNNRTKSQQNFQHTLRMQQMMAPSMPNISN
MYHQQQQQQQQQQQMPLQQQQQLQQQPPMSSSQSMQNVNDFQGGFQNGGGLEYQHARRSQ
IHEPATLYELQQQQLQQQQQQQPSPNFIALPPKPLGSLQSPNKQAAPPSTAPKPQQQQRM
SQTGYLAGHGPAGVLGEDKPPLPPTATHPLFKATAQLAPGMNYVASTLDPPKGSYLPTNQ
QAANRPPLHSGSNPWEREEREKDLEMRREHIRQWREQQISDLSQTISRSGQQEEQLKTLI
LERDFERRALELQEQEDQDQDQQYDKENIQELFRLAASGQVSAIQTPITSYRQTEIKMAE
ITDSSSSPVDQVAAQPPPMAPMSSHQQQQQQQPKSILKHNRYSEGGAGSSGGAPSSPSKS
QKSASFADDRHLQTEHPISSLAKELTQLTMLDKDNNNETLDAAVPPPPPPERNSSYLIMS
QQKLRGSTSSSMGLLKTATSNQAAAAVEIKKASLLNTQSNNNNNNNSLSGNLNNNSTSSM
QASPLSAMELNAAYVSATGTGMVGGLGSPPPPPPLLQRDNKRVSFHDEENNFVSGNSQQQ
QQQQLQQQYIIENYGMEHQDLDTIREDASYLQHNLDASMLPSMPATPDAALWNTSVQSTP
GVIGAQEVYRDPRTRRLAEKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDNTPKDKL
KISRAQRDIDAVH
Download sequence
Identical sequences Q296A4
7237.FBpp0284459 XP_001359408.2.19638 FBpp0284459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]