SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0284843 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0284843
Domain Number 1 Region: 398-593
Classification Level Classification E-value
Superfamily Tropomyosin 8.39e-55
Family Tropomyosin 0.00000139
Further Details:      
 
Domain Number 2 Region: 588-657
Classification Level Classification E-value
Superfamily Tropomyosin 1.22e-17
Family Tropomyosin 0.0004
Further Details:      
 
Weak hits

Sequence:  FBpp0284843
Domain Number - Region: 865-888
Classification Level Classification E-value
Superfamily Tropomyosin 0.000392
Family Tropomyosin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0284843   Gene: FBgn0248912   Transcript: FBtr0286405
Sequence length 892
Comment type=protein; loc=2:join(28038430..28038787,28039321..28039672,28040234..28040651,28043559..28043735,28047444..28047577,28047762..28047879,28052521..28052591,28054027..28054102,28054283..28054345,28054908..28054970,28056640..28056709,28058923..28059615,28061332..28061417); ID=FBpp0284843; name=Dpse\Tm1-PA; parent=FBgn0248912,FBtr0286405; dbxref=FlyBase:FBpp0284843,FlyBase_Annotation_IDs:GA27547-PA,GB_protein:EDY68582,REFSEQ:XP_002138024,FlyMine:FBpp0284843; MD5=5c4f1509e0fcb9bb0810d5b24b41ecbe; length=892; release=r2.13; species=Dpse;
Sequence
MYEKTLTIGNAKVNNAYEWQKVSYNNKSTTTAKPKQINHKTSKSSAKTATKTNATKIAAS
AAAPTTTPKETVKPSTQPLQNNQKYKYFGSAARRLAHQIKRAHRHLLTSGGNDKQPQQKP
GKQKQQPRNKRASNKQLLKSDKPKPKAGKHQRQQRGSSRQSRSDGALSGQSSRWCSIEAQ
LNVLDDLLYYCDEEAELYLAQLYERYQQLICDQSSNSEYESGSTDFWSDASDSEDNIGDK
SEKSEKGEKSERKKKSSSSSSGKRERSKRHGHGAAGTSAMEASSDSLATDLSAGAIDEGI
ALGDDDDTQSAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFN
IIRNELHNIMNTQLKRCPNETPTTKLKMTTSIPQGTLLDVLKKKMRQTKEEMEKYKDECE
EYQKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESER
IRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLAMVEADLERAEERAEQ
GENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEATQKEETFETQ
IKVLDHSLKEAEARAEFAERSVQKLQKEVDRLEDETIVEKEHYALIGDSLDWTFVELMGM
PPFYNDRYPKPPTPELTEEDLARIAEAEAQAQAEAEAKAQAAEAKAQAAAALAEALAAGV
DPATLDPALVEAATAGEEPVPIKIPTPPPKEPTPPPPPPPPFEYSIDLPPEGAEVPYVKN
AEPGDMLPPVEGAPEGEAAAVPPVEGEAAPAAAPAEGEAAAPAAAPAEGEAPSVAAPAEG
EAAAAPPAGEAPPPPPAAAEAAPADDLVLEKERYKDIGDDLDTAFVELILKE
Download sequence
Identical sequences FBpp0284843 7237.FBpp0284843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]