SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0286604 from Drosophila pseudoobscura 2.13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0286604
Domain Number 1 Region: 54-181
Classification Level Classification E-value
Superfamily Plus3-like 1.7e-36
Family Plus3 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0286604   Gene: FBgn0071714   Transcript: FBtr0288166
Sequence length 247
Comment type=protein; loc=XL_group1e:2135459..2136202; ID=FBpp0286604; name=Dpse\GA11664-PA; parent=FBgn0071714,FBtr0288166; dbxref=FlyBase:FBpp0286604,FlyBase_Annotation_IDs:GA11664-PA,GB_protein:EAL31706,REFSEQ:XP_001354651,FlyMine:FBpp0286604; MD5=5671a430b387a105213e0dc5b50feba7; length=247; release=r2.13; species=Dpse;
Sequence
MNSKAKPSLRIEKSRRPISEIAQELRRLKASPLRIDDEKELPKPSVSDRPVKRLEQLEPV
RLTRHRITQLLVRPAFEQAVTSCFVRVNVNGQGEQPEYRIAEIVGVEELGLGYFVDGIPT
NITLRLRYNSVPMLHELNDISNMAFSLPEFQLWCDCCVNQGISPPTNSVIARKKIELYNA
LQSEAKALALIKQTCTLNMRPAHRGGILERHGATYPWRLQRPREATLSTPKPPSNQDVEL
NLESESD
Download sequence
Identical sequences Q29HQ2
XP_001354651.1.19638 7237.FBpp0286604 FBpp0286604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]