SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CAZ84369 from Tuber melanosporum Mel28 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAZ84369
Domain Number 1 Region: 202-424
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000785
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 376-592
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000719
Family Tropomyosin 0.011
Further Details:      
 
Weak hits

Sequence:  CAZ84369
Domain Number - Region: 15-238
Classification Level Classification E-value
Superfamily Tropomyosin 0.000183
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number - Region: 557-663
Classification Level Classification E-value
Superfamily Tropomyosin 0.00517
Family Tropomyosin 0.0043
Further Details:      
 
Domain Number - Region: 841-1028
Classification Level Classification E-value
Superfamily Tropomyosin 0.00752
Family Tropomyosin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAZ84369
Sequence length 1411
Comment pep:novel supercontig:ASM15164v1:FN430327:463640:467915:-1 gene:GSTUM_00008567001 transcript:CAZ84369 description:""
Sequence
MGFPSSAVDSAALTSSQVQTEISVYETESYSRRISELEDQNGGLQRMIDNLTNRIQDMQE
EVRDSQTGLAEQEERTEVLEAEALKLKNQKQTLRMRIIELEEMEGERLESMHDLMVQTDE
AVDERAILLEEKAEGLNIQVSELREMVEAVSTEKRAVDTRLLETMDQVSRLEAAVEAGER
SREDVNSQLQDLGKMIELLRKEITILEAERAEIVAEIDELRDQLATLEREIGELRVENVG
LKQEVSIQTEKITGLEQTVDHFEKDKAALQESLHLLELDIETLEEAAKVVEETKDRLEDE
IEVLRDELKSQTNATEAAQKASEAFQRTISELHSQVGSLEKMIELSNQEKKSFLHNIDAL
QVRVSDLEQQHRISGDDKGNLEAQICRLNGQIHKLEEAVEVSETDKEILENTVEDLQNRV
SQHQSALENAGSNKTRLESDIAQLTSQVTSLQEAAIASNLEKEGLEREIDFLQKQVSAFE
ATVKLSDDLTADLEKEILSLNTQIDMFKQAEEAVKNEKEQMEINMSGMMARIQGLTRAGK
IAQEKKEDLDRTIASLNLQISILEEERDDAQAENSRLKSEIAECKEEIATLTSMLDHSNR
ERESLKQNIEELEEKVVFLEDVVQDAHGGNTSLRQDINALNAEIRTLKQASALADEEKSM
IQQKIRPYIHGEQSLDMAVEEVLTELVMERNRADENERLRTELSKKIKILAQTDEGMNMG
SLNPEETVERLTDRFREVRGYVENLYSQCAQSENSPFEGHELDDFAWTGSNEDALEVLRS
LVGGLYEKVSEAQARTVEVEKEKEKERKQRSLYGQYLDDIAIAVGVEGEQLPAEEGVPGL
VTLRLSELRQQIGSTGEKVEELQVSIQRKNDTLKSMEMDIEEAGEREAGLSRKLGDAAAA
HEAAALQLNRAHVQIEGLNQVIQDKVAEIEDLGADLEASSENERRLLDTIDQQASEHDIT
VRELEGKRGEAIARLKELLEEKVLAKTRAEHMVAEKAKDSEIIRELEEQAAGWKAQYDAL
NVRLDMMKADHEDKVAQLKDTIAGNEGKISSLSEELREALEKSERDISALEDQLRSARDE
IANQNSALSKVSAERDEFSRQLEMEILSSRGAVTGLEKRISEIKNEFQLQQSRDHNRLSD
LKSELEAHKTKSLQEQEHSRAEIHARGEVIRSHKARISELEAMLNETEESEATLEEGIKS
CESQLQLSYEETARIKEALETEKDKLMEELAELRIEIERTRANLTSDIEGLRTILEGKEV
RINDLEAVVGILRSERIKLTETVGELEAEQIRYQDMLESERQSGLEAVQALSHQAEKYMV
RFGEVKQQYIRESAKRQAEGKKANKRLREQDDEVDNDAADMPLHAPPTPASTIPRPLSVT
HSAKKRESKRRKYDSGIGVEEEEECTSVVPA
Download sequence
Identical sequences D5GIM6
CAZ84369 GSTUMT00008567001 XP_002840178.1.11696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]