SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51244783|ref|YP_064667.1| from Desulfotalea psychrophila LSv54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51244783|ref|YP_064667.1|
Domain Number 1 Region: 446-554
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51244783|ref|YP_064667.1|
Sequence length 613
Comment high affinity sulfate transporter (SulP) [Desulfotalea psychrophila LSv54]
Sequence
MTIKKFFPCTQWFKLLNAETVKLDFMAGLTGAIIVLPQGVAFATIAGLPPQYGLYTAIVI
PIIAALFGSSYHLVSGPTTAISIIVFASVSRFAEAGTPEFISMALMVTFLAGVYQLIFGA
LRLGSLINFVSHSVITGFTAGSAILVMTSQLKSVTGISFAKGQSFYNTWISLFAQLEKIN
PYALGIALATLAVALISKKIFPRAPNLLAGMIFGSILALFLKNYTETITFVAEIPAQLPQ
LSSPTFSMASLRRLAPEGLAIALIGLIEATSISRSIAAKSNQKLDSNQEFIAQGLANITG
SFFSCYAASGSFTRSGLNYEAGAKTPLSAIFAAILLMLIVLLVAPMTAYLPVSAMGGVIF
LVGYNLINFKQIKEIIEHHRSETAILAVTFFGTLFVHIEFAISFGVLLSLMIFLARTSTP
YIPSLCPIPTRTGSNHFIEVCEDVCAECPQFKIIRIDTPIYFGSVSYILNHISNIIEKEK
IKHILIVAFGINGIDLTGAEALVNENNQLRKIGGGLYFVDHDLAHKASTEHQYLLDHIGQ
KHFFQSKVEAINTIFQKLDRNICADCTVRIFAECLSEEHNKELLALKEDYLKRELYMGSC
SHGKVQKKGASHK
Download sequence
Identical sequences Q6APR4
gi|51244783|ref|YP_064667.1| 177439.DP0931 WP_011188174.1.98904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]