SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51245114|ref|YP_064998.1| from Desulfotalea psychrophila LSv54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51245114|ref|YP_064998.1|
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.42e-48
Family Voltage-gated potassium channels 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51245114|ref|YP_064998.1|
Sequence length 264
Comment voltage-gated potassium channel [Desulfotalea psychrophila LSv54]
Sequence
MGRQSPLSLVSMEKFVEIRIQLRDILENSTTRMSKIIYWVIHCLIITALVSFTVHTLPEL
SPTAKQILYLVDLACLCLFSVEYLLRLFAAENRFRFVCSFFGIVDLLAILPYFLTLGLFD
MRVLRLLRLLQLFKVARYNKVFKRYYRACLLLRVDLAFFLAVALITVYLAAVGIYHFENL
AQPDKFGSIFQSLWWSVVTLTTVGYGDVFPITTGGKVFTFVLLIIGLGLVSVPAGLVASA
LGEAREIEKVEEKGKPEYGETHEQ
Download sequence
Identical sequences Q6ANT3
gi|51245114|ref|YP_064998.1| WP_011188503.1.98904 177439.DP1262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]