SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51245962|ref|YP_065846.1| from Desulfotalea psychrophila LSv54

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51245962|ref|YP_065846.1|
Domain Number 1 Region: 171-385
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.9e-52
Family ATP sulfurylase catalytic domain 0.0000476
Further Details:      
 
Domain Number 2 Region: 10-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.29e-41
Family ATP sulfurylase N-terminal domain 0.0000421
Further Details:      
 
Domain Number 3 Region: 393-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-29
Family ATP sulfurylase C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|51245962|ref|YP_065846.1|
Sequence length 569
Comment bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase [Desulfotalea psychrophila LSv54]
Sequence
MPFQKNINCKYPETLLVDPEQIEGLKAEALDLISLTLSVEQICDLELLLNRGFYPLVAYM
DQASYLSVLKNMRLTDGTLWPTPISLAVSKNRVAGLTIGQRLALNDQEGFLIAILTISDI
WQADTRLEAKAVYGTTDSARHPGVRKLYDCSGDYYLAGSLEGISLPVHYDFQSLRLSPAE
TVQRFMTKGWQRVVGFQTDEYLHYGHHKMIMAAAQEIGAAVFIQAQINCPGEITHYTHVR
CHQAFTKLFPINMAGLGLFALPAKKTGPREALLQAIIKKNFGCTHFMVAPDHADPFAVMT
DEKALFYPRGEAQKLVAYYEKETEITMIPQRGVGYCKKDKKYIFQGAKGAENSSLIDSKG
LMGRLKREEEIPPWFTCPKIVQEIRHDFLPRSGQGFTIFMTGLSGAGKSTIAKVLQVKFA
EMRERPVTLLDGDIVRLNLSSELSFSQKDRNLNVTRIGFVAGEITKNGGIALCAPIAPYE
ESRQVNRRLISNYGGYIEVYVATPLQVCEQRDSKGLYAKARSGRIKNVTGITDPYIPPTN
PEITIDTTNINPMDAAEKILLYLKGEGYL
Download sequence
Identical sequences Q6ALD6
177439.DP2110 gi|51245962|ref|YP_065846.1| WP_011189351.1.98904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]