SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0181645 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0181645
Domain Number 1 Region: 420-549
Classification Level Classification E-value
Superfamily Plus3-like 3.14e-40
Family Plus3 0.0000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0181645   Gene: FBgn0155141   Transcript: FBtr0183153
Sequence length 764
Comment type=protein; loc=scaffold_4:join(4181029..4181109,4181249..4182179,4182246..4183421,4183485..4183591); ID=FBpp0181645; name=Dper\GL17538-PA; parent=FBgn0155141,FBtr0183153; dbxref=FlyBase:FBpp0181645,FlyBase_Annotation_IDs:GL17538-PA,GB_protein:EDW35967,REFSEQ:XP_002018128,FlyMine:FBpp0181645; MD5=ff7a46b079844973d442666948415d7c; length=764; release=r1.3; species=Dper;
Sequence
MGKRRTQSLIDSNSSDSDSGSDTKLESDLLSLAKKRKKPQNASKASSLSDSDSDWANNKS
GAPATKKKKRPKRASRNSSSSESNWDDESQDESVQPPPVEKKPEEPPKTGNHSEHEEGEV
SDSDSDNSKSNSSSGSDSSSSSSSSSDAEFDDGFDDDMMGDEEDRKRLNDLSEKERETEI
FKRIEQREIRRTRWEIERKLKLARRGERSEKSRSKGERAKKKKEKKAKKSKELPPSMPQP
PNSVLSELEPKPISEVGSNSPLPQSSNRDVASTSAAVASILNDRESDDQAGAGMGDYFDH
KERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRQAERDRDDKEELESVS
GCKSAVKLKASEIYSDDSGSSDWDEDEKPTGKRSRSISSKASSESEDDDKTTKSPVFISN
REDLNKLRLSRHKMERFVNLPIFESTVLNCFVRIIIGNNGQKPVYRVADITGVVETGKIY
SLGTTRTNRGLRLKHGTQERVFRLEFIYNQEFTENEFQKWHEVCQHAHVQMPSIELIEIK
ANDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAMLRGDYDIAQDL
SQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVQDAEKAIMEEARANKGQKISDPF
TRRITQPRMGFKGAKKEEEDPQLAPLPPPPPGKKRPNEAGSSNSKPTDAKDFSLYSLHDF
DIDLDVPLPVNSTNSVPKPANKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4GHJ7
FBpp0181645 XP_002018128.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]