SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0184035 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0184035
Domain Number 1 Region: 54-181
Classification Level Classification E-value
Superfamily Plus3-like 3.14e-36
Family Plus3 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0184035   Gene: FBgn0157525   Transcript: FBtr0185543
Sequence length 250
Comment type=protein; loc=scaffold_18:1003328..1004080; ID=FBpp0184035; name=Dper\GL19928-PA; parent=FBgn0157525,FBtr0185543; dbxref=FlyBase:FBpp0184035,FlyBase_Annotation_IDs:GL19928-PA,GB_protein:EDW27842,REFSEQ:XP_002023665,FlyMine:FBpp0184035; MD5=565fb6f8e56668535657316fdda4245a; length=250; release=r1.3; species=Dper;
Sequence
MNSKAKLSLRIEKSRRPISEIAQELRRLKASPLRIDDEKELPKPSVSDRPVKRLDQLEPL
RLTRHRITQLLVRPAFEQAVTSCFVRVNVNGQGEQPEYRIAEIVGVEELGLGYFVDGIPT
NITLRLRYNSVAMLHELNDISNMAFSLPEFQLWYDCCVNQGISPPTNSLIARKKIELYNA
LQSEAKALAVIKQTCTLNMRPAHRGGILERHGATYPWRLQHPREATLSTPKPPSNQDEEL
NLESESDESA
Download sequence
Identical sequences B4GYI6
XP_002023665.1.64850 FBpp0184035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]