SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0188370 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0188370
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.62e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0002
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.4e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0188370   Gene: FBgn0161853   Transcript: FBtr0189878
Sequence length 105
Comment type=protein; loc=scaffold_0:join(7487238..7487309,7487422..7487667); ID=FBpp0188370; name=Dper\GL24263-PA; parent=FBgn0161853,FBtr0189878; dbxref=FlyBase:FBpp0188370,FlyBase_Annotation_IDs:GL24263-PA,GB_protein:EDW24663,REFSEQ:XP_002013677,FlyMine:FBpp0188370; MD5=8a87bdbbd4ccb53d63eef8d6cf201bc9; length=105; release=r1.3; species=Dper;
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKA
GKLNTYRFCDNVWTLMLNDVEFREVHEFVKVDKVKIVACDGKSEF
Download sequence
Identical sequences B4G4Z7 Q299B6
FBpp0188370 FBpp0282111 XP_001358646.2.19638 XP_002013677.1.64850 XP_016978530.1.97277 XP_017144912.1.22881 XP_017156460.1.22881 7237.FBpp0282111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]