SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0174235 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0174235
Domain Number 1 Region: 722-885
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.26e-17
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 948-1014
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000144
Family cAMP-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0174235   Gene: FBgn0147738   Transcript: FBtr0175743
Sequence length 1100
Comment type=protein; loc=scaffold_31:complement(356913..357048,357122..357438,358281..358357,358442..358592,363171..363308,363372..363507,363707..363871,363969..364207,364378..364543,367634..369340,375088..375158); ID=FBpp0174235; name=Dper\GL10128-PA; parent=FBgn0147738,FBtr0175743; dbxref=FlyBase:FBpp0174235,FlyBase_Annotation_IDs:GL10128-PA,GB_protein:EDW32853,REFSEQ:XP_002025946,FlyMine:FBpp0174235; MD5=43d99489f4ed7b3fe2854656d6cab521; length=1100; release=r1.3; species=Dper;
Sequence
MHVKHTQRRVSGPGAFGTFTNDQRASRDNLYPDDHQQQQQPPQRHSHSHQHLVRQSLTSL
SHGQASSGSGPAGDEQRAQQQQQQHRHRSSSSRLSSGISKQNSSDSRSGLRILDSHSPVS
CGTHSVSSTGGHSALYDACHEYTRSLSAAPTVEARSGAGADASLLKGHYSDQQLAQPEPD
PEPDPERDRDRDRDRDRERERRHLTNLNLNLNSEYDYSGSDKQQLVNETYIFKCIANSPS
FLRTNKIKEQSKKLRNLSLKTRTAKKKGQIISKSNAVSDNSLHPGDKYLNLYLVEKKHSL
QPQATSTSASTSTPNPHSASAPASSSSSSTATTGRPQQQSQQLPALSAVAARQQQLLLNG
SLKSKTKTFPAYRASVKSESEYRGSGSNTIPTTGKSPPVPHSLAAKISSGKNCNLLQSAG
NKQLSVSSNSCHKLHAQGHGHGHGHYAGAQAHHLASSPKSSVSSNGHLNKYCLTDLTRRK
AEFNRQLSAPTDYTHHSSSNGSQQEGSSEAANEAVGESTITVASAGVLGNGHGYPYIHQA
SATAPANLKASLQLHNFGVHHPYPYPSRPTSTSCTNSFNRRHIRRHKSKLGERLLSGDSE
ESVRCSYCSVLNVNENDLRISFENTCTDSLVTAFDDEALLICDQGTEMVHFDDVSLYGTP
KEEPMPNIPIVSEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWV
IHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNF
RNRIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSFQILHAG
RALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLILHDALDRTLER
LLAVLSANVAGFSIKLLGIHQRVAGILLAGAVFVGIVQGYVAHAVHWLRQVATSLSDGSY
FGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKN
PNIMQQKDEQLSNPESNTITAVVNALAAEADECKDDDMDLKENLLHGSESSIAEPVQTIR
EGLPRPRSGEFRALFEGNTP
Download sequence
Identical sequences B4H517
FBpp0174235 XP_002025946.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]