SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0181936 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0181936
Domain Number 1 Region: 409-503
Classification Level Classification E-value
Superfamily TAFH domain-like 7.85e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 828-877
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000942
Family TBP-associated factors, TAFs 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0181936   Gene: FBgn0155432   Transcript: FBtr0183444
Sequence length 1038
Comment type=protein; loc=scaffold_24:complement(1262645..1262803,1262863..1262988,1263059..1263232,1263308..1264204,1264287..1264511,1264579..1265163,1266060..1266377,1266763..1266873,1267144..1267305,1267978..1268337); ID=FBpp0181936; name=Dper\GL17829-PA; parent=FBgn0155432,FBtr0183444; dbxref=FlyBase:FBpp0181936,FlyBase_Annotation_IDs:GL17829-PA,GB_protein:EDW30450,REFSEQ:XP_002024977,FlyMine:FBpp0181936; MD5=72f3c3caa662c6319de34b7257b71eb3; length=1038; release=r1.3; species=Dper;
Sequence
MNSQTTAGNRITFTNQLPNGTINIAGNPGSGGGPTIISTAQLPNTTTIKTITAGIGGHHP
GLTQVHHQQSPHQQQQTQSVGATQTQTLVIKSNHHAVTLPAGLVSSAPAGIVTMTKTINQ
GQPLLNSMLPAGVVVGMRHQSPAQQQQQKNVSANPLSRVVINSHMAGVRPQSPSITLNTL
NTGQTPALLLKTDNGYQLLRVGTATTTGPPTHSTAQNDCPYITLTIPSSNSNNNHIINAS
TTTTTNTTTTTTNNNNNSKPASNQQQQQQQKLQQQLKAQQQQKQQQQQQQQQHAAATAAA
AAAAAANVPVTIKIKQNSMTNTTASNNIIVNSVASSNAHGYTTSSQPPHLTQLNSQAPHL
PQITQIQTIPAQHQQQQQQQQQQVNNVSSSGGAQATTSTTTTTTAQQGNTKEKCRKFLAN
LIELSTREPKPVEKNVRTLIQELVNANVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLL
RQALYSKELVIEGIKPPPQHVIGLAGLSQQLPKIQAQIRPIGPSQTTTIGQTQVRMITPN
AMGTPRPTIGHTTISKQPNIRLPTAPRLVSTGAIRTQIPSLQVPGQANIVQIRGPQHAQL
QRTGTVQIRATARPQNTTPTNKLTAVKVGQTQIKAITPSLHPPMLAAISNSSGPPPTPTL
SVLSTLNSASVTSLPVPSLPTVHLPPEALRAREQMQNSLHHNNNNHFEPKLVEIKAGSHL
ERMNASLTPISGKTLVKASPAISKAAASKKRRDALDAKDESKANSASGAAAAANSFFQQS
SMSSSMYGDDDINDVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNMPALQARIR
AITTEVGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQ
IKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRD
ANLTALQAIGPRKKLKLDSDAASAGVGSSGGGLLSSSGSAPTTLRPRIKRVNLRDMLFYM
EQEREFCRSSTLFKTYLK
Download sequence
Identical sequences B4H298
XP_002024977.1.64850 FBpp0181936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]