SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0186306 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0186306
Domain Number 1 Region: 1007-1115
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-24
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 257-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.65e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 375-469
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.42e-20
Family FHA domain 0.00042
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.05e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0186306   Gene: FBgn0159791   Transcript: FBtr0187814
Sequence length 2117
Comment type=protein; loc=scaffold_3:join(4544185..4544289,4544350..4544458,4544530..4544723,4544802..4545320,4546241..4546322,4566277..4566629,4570146..4570267,4571532..4571586,4571653..4571939,4572295..4572504,4573678..4574143,4574225..4574749,4574815..4575062,4575124..4575242,4579402..4579683,4579835..4580084,4581439..4583551,4583610..4583731,4583793..4583985); ID=FBpp0186306; name=Dper\GL22199-PA; parent=FBgn0159791,FBtr0187814; dbxref=FlyBase:FBpp0186306,FlyBase_Annotation_IDs:GL22199-PA,GB_protein:EDW34339,REFSEQ:XP_002017239,FlyMine:FBpp0186306; MD5=f81dab3df9d28b19a61c59758ed09e09; length=2117; release=r1.3; species=Dper;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDPPTANGSQLGL
GNGLGSGSNSSHMNGNAGGSGPDGSDAVAGKLYTELPETSFTRSISNPEAVMRRRRQQKL
EKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVVREMLTKYGLEKA
DPLHYCLVQVNSDGTEYILDDDECPLSILMNHPTSRGSIMFHVRRRPADSQPRRRKKKPL
GAANGASHMSGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCLQLFGPSIQPRHC
LISLHEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYRFLDSPTDGRYNL
ALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSEYDQHQQSNQSSGYHNNNNINNS
SEHPLSSTLRGDVVDSKATGQDQGANNATGLLGGTHTMAYDGQSLEGNLENETKSISSMK
SSGSNSQDRSPKMPGSGLLAGGGGSGSGDAQGQEPILPAVLEFPETHQELFLRHIISELD
VNVPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTMFLHHVANLVYSVVQEQYTD
PRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQTLNQ
FLSENIDHDSAAGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIVANSQ
MCTSDWGKVMTERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQLACS
CFRLNSLQMGALLQQEKIPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLALLLP
DDGFSCDVVRGIPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSAMSNKL
PQPELQLIKLHKNSNGMGLSIVAAKGAGQERLGIYIKSVVPGGAADADGRLQAGDQLLRV
DGQSLIGITQERAADYLVRTGPVVSLEVAKQGAIYHGLATLLQQPSPVIQRGNRRMSERD
LTRMGAAESSKSLGGIGGPLIATGHANHSLSLSQHLNNSHNMNSNSNSNSHNSNSNSSII
NPLTAHLPNSKSVPALHHHTGSGTISLANSKSRSTHSLHNNTSAAMGGIGGGVGPGPGPG
VGAGMLGQPNGSHNNANGNGNGNGNEQGFYQNLSVYRAQNQSQPILNERPPMSTHAAMNA
YNGNSPLAQQQQQPQQPQPSPYQQQQQQLLQSNANLPPTRPVSAYYHSQQTAQQQLQQQQ
QQQHTLQQQQFAHSSSNLNGQQQQQQAQHQHQLTLNNRTKSQQNFQHTLRMQQMMAPSMP
NISNMYHQQQQQQQQQQQMPLQQQQQLQQQPPMSSSQSMQNVNDFQGGFQNGGGLEYQHA
RRSQIHEPATLYELQQQQLQQQQQQQPSPNFIALPPKPLGSLQSPNKQAAPPSTAPKPQQ
QQRMSQTGYLPGHGPAGVLGEDKPPLPPTATHPLFKATAQLAPGMNYVASTLDPPKGSYL
PTNQQAANRPPLHSGSNPWEREEREKDLEMRREHIRQWREQQISDLSQTISRSGQQEEQL
KTLILERDFERRALELQEQEDQDQDQQYDKENIQELFRLAASGQVSAIQTPITSYRQTEI
KMAEITDSSSSPVDQVAAQPPPMAPMSSHQQQQQQQPKSILKHNRYSEGGAGSSGGAPSS
PSKSQKSASFADDRHLQTEHPISSLAKELTQLTMLDKDNNNETLDAAVPPPPPPERNSSY
LIMSQQKLRGSTSSSMGLLKTATSNQAAAAVEIKKASLLNTQSNNNNNNNSLSGNLNNNS
TSSMQASPLSAMELNAAYVSATGTGMVGGLGSPPPPPPLLQRDNKRVSFHDEENNFVSGN
SQQQQQQQLQQQYIIENYGMEHQDLDTIREDASYLQHNLDASMLPSMPATPDAALWNTSV
QSTPGVIGAQEVYRDPRTRRLAEKQQQQQQQRAGDAVPEKLSFKEKMKMFALESGEDNTP
KDKLKISRAQRDIDAVH
Download sequence
Identical sequences B4GFF4
XP_002017239.1.64850 FBpp0186306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]