SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0187168 from Drosophila persimilis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0187168
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 7.59e-61
Family CutC-like 0.00000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0187168   Gene: FBgn0160651   Transcript: FBtr0188676
Sequence length 259
Comment type=protein; loc=scaffold_0:complement(10607466..10608245); ID=FBpp0187168; name=Dper\GL23061-PA; parent=FBgn0160651,FBtr0188676; dbxref=FlyBase:FBpp0187168,FlyBase_Annotation_IDs:GL23061-PA,GB_protein:EDW25041,REFSEQ:XP_002014055,FlyMine:FBpp0187168; MD5=544b6ba56604fe47a929d384a78f10a1; length=259; release=r1.3; species=Dper;
Sequence
MSGHDIKLEVCVDSIGSAFAAEVGGASRIELCSALGEGGLTPTVGTLKTLKDSFTLPIFC
MLRPRRGTDFLYSEEEMQAILTDMALLREHGADGFVFGALNTDRTIDANKCRQVMQQSGG
LPVTFHRAFDLTDQKRMHEHVELLRELGFKRILSSGFRPSAAEGADCLAQLIAKHHRDII
IMPGAGIKVANLEEILTVSRCLEFHASAMDTAGEDYTAPTTTRMECDVTMGKQDIDPYYG
TNSNVVRKMVTIANAMSCR
Download sequence
Identical sequences B4G3T6
FBpp0187168 XP_002014055.1.64850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]