SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15805387|ref|NP_294081.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15805387|ref|NP_294081.1|
Domain Number 1 Region: 14-236
Classification Level Classification E-value
Superfamily Folate-binding domain 3.45e-44
Family Aminomethyltransferase folate-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15805387|ref|NP_294081.1|
Sequence length 303
Comment hypothetical protein DR_0358 [Deinococcus radiodurans R1]
Sequence
MPPTLCPVFSPYPDLMWTRLPSSGLRVTGADRTDFVHGQMTGDLRGAPTPGLVPCAFLNV
RGQIEQFARAYRRPDDIYLHLDAGQAPLLAARLRRYIIFDQVELEDVSEVLRTVHVWDQA
VPGWDDAGAGAQQWTLGGSLVLGGRVNRSGQPGVDLHYLARDEEAVLAALGGEERPLSEL
DALRVAAGIPDIQRDGLTGTLPQEVGLDVSGPLPAISYRKGCYVGQEIMARIEARGQTRF
HLARVAGEGLPSHAEIRQGDKVVGQSGLSTGPLALARLRRELEDGAAVEVGGVSARVQLL
GHD
Download sequence
Identical sequences Q9RXF5
gi|15805387|ref|NP_294081.1| 243230.DR_0358 353968 DrT7 NP_294081.1.55610 WP_010887003.1.45201 WP_010887003.1.61927 WP_010887003.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]