SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15805753|ref|NP_294450.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15805753|ref|NP_294450.1|
Domain Number 1 Region: 25-149
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.19e-65
Family Nqo15-like 0.0000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15805753|ref|NP_294450.1|
Sequence length 151
Comment hypothetical protein DR_0727 [Deinococcus radiodurans R1]
Sequence
MCAGCPFAAEGTLWLRDVKLPQMANADKAALYRQWVELLGWLGDEARSRGLSIDKVADFP
DYIYRMERPYDLPTTVMSVNVSQDGQALLVAAVSPRHVDLGGISLRLMGGSKHWHLHAGA
GGLLEGKRPFTRERLSVLLDGVMRGNGTVAV
Download sequence
Identical sequences Q9RWE2
243230.DR_0727 gi|15805753|ref|NP_294450.1| NP_294450.1.55610 WP_010887372.1.45201 WP_010887372.1.61927 WP_010887372.1.86829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]