SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15805990|ref|NP_294690.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15805990|ref|NP_294690.1|
Domain Number 1 Region: 21-411
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.62e-113
Family Homocysteine S-methyltransferase 0.00000576
Further Details:      
 
Domain Number 2 Region: 905-1237
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.35e-108
Family Methionine synthase SAM-binding domain 0.0000000886
Further Details:      
 
Domain Number 3 Region: 368-642
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.63e-84
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0013
Further Details:      
 
Domain Number 4 Region: 752-882
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.44e-41
Family Cobalamin (vitamin B12)-binding domain 0.00000365
Further Details:      
 
Domain Number 5 Region: 662-748
Classification Level Classification E-value
Superfamily Methionine synthase domain 9.29e-28
Family Methionine synthase domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15805990|ref|NP_294690.1|
Sequence length 1258
Comment B12-dependent methionine synthase [Deinococcus radiodurans R1]
Sequence
MSHHPEASASANPSINHQPSTITEAARQRILILDGAWGTQLQRANLTEADFRWDEADPTR
MYRGNFDLLQLTKPDVIRAVHRAYFEAGADIASTNTFNSTTISQADYGTEALAYAMNREG
ARLAREVADEFEARDGKKRWVAGSVGPTNRTATLSPDVERPEFRNVTYDDLVAAYSEAIT
GLMEGGADLLLIETVFDTLNAKAALFAAQDVFAAQGRELPVMLSGTITDASGRTLSGQTP
EAFAVSTEHAGLFSLGLNCALGADLLRPHLRAIAANTEALVSVHPNAGLPNAFGEYDETP
EHTAAVLADFAREGLVNIVGGCCGTTPEHIKAIAEAVKDIPPRQALQLPPYLRLSGLEAF
TLTPETNFVNVGERTNVTGSPKFSKAILAGDYDAGLKIARQQVTNGAQIVDINFDEGMLD
GEGAMVKFLNLLAGEPDISRVPLMLDSSKWEILEAGLRRVQGKAVVNSISLKDGEARFLE
RARLLRRYGAAAVVMAFDEQGQADNLARRREILGRAYRLLTEQADFPPQDIIFDPNVLTV
ATGIEEHDRYALDFIEATRWIKENLPAAKVSGGISNVSFSFRGNNHVREAMHAVFLYHAI
RAGLDMGIVNAGMLAVYEDIEPELREAVEDVILARRPDATERLLTLADRYKDIKRESAAQ
SAWRDLPVQERLRHALVQGVADHVDEDAEAAYQELGSPLAVIEGPLMDGMNVVGDLFGAG
KMFLPQVVKSARVMKKAVAYLTPYLEAEKAESSSKGKVLLATVKGDVHDIGKNIVGVVLA
CNGYQVTDLGVMVPGEKILDEAERLGADVIGLSGLITPSLDEMVNVAREMTRRGVKTPLL
IGGATTSRAHTAVKIDPAYDGTVVHVLDASRAVTVTNDLLTDEAAYAGRVQGEYDTLRER
HGERQVRLIALAEARARAPQLSAAVPPAPHDLGRQVVEQPIAELLPFIDWTPFFIAWEMK
GIYPGILTDPLRGEEARKLFADAQALLEQVIADGSLRARGVIGLWPAHGDDIVLDDAAMG
RGETLDFETHELAAGREPLPNMPRLHTLRQQRDQTTPNTALADFVAEGGDHIGAFATAIF
GAEELAQQFEAQHDDYNSILVKAVADRLAEAFAEKLHRDVRVRHWGYAEGEALDNTDLIK
ERYQGIRPAPGYPAQPDHTEKRTLFELLDAESIGLRLTESCAMTPAAAVSGLYFAHPEAR
YFAVGRIGRDQVENYAARKGWTVQEAERWLGPLLAYSAGPGPEASQKALGAELTGAQS
Download sequence
Identical sequences Q9RVQ6
gi|15805990|ref|NP_294690.1| 243230.DR_0966 NP_294690.1.55610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]