SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15807136|ref|NP_295865.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15807136|ref|NP_295865.1|
Domain Number 1 Region: 92-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000811
Family NfeD domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15807136|ref|NP_295865.1|
Sequence length 159
Comment hypothetical protein DR_2142 [Deinococcus radiodurans R1]
Sequence
MPDWLPTWQAVHPWHWWVFGALLLILEILAPGVFFVWLALSAFGVGLLTFVLPFLDVPGQ
LLLFAGLSVAAVWLGRRYVSRLVLGGSEGEQLNTGAQRLIGRTVTVVTPIEHGVGRVRVG
DSDWRARGPELPAGTPVRIVGVEGATLVVQEEKRLVEAG
Download sequence
Identical sequences Q9RSI2
NP_295865.1.55610 WP_010888773.1.45201 WP_010888773.1.61927 WP_010888773.1.86829 243230.DR_2142 gi|15807136|ref|NP_295865.1| GO.2803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]