SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15807820|ref|NP_285475.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15807820|ref|NP_285475.1|
Domain Number 1 Region: 4-552
Classification Level Classification E-value
Superfamily Urocanase 1.28e-248
Family Urocanase 0.00000000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15807820|ref|NP_285475.1|
Sequence length 558
Comment urocanate hydratase [Deinococcus radiodurans R1]
Sequence
MTTHEPRTVRAPRGPHKTAKGWIQEAAKRMLMNNLDPEVAEHPESLVVYGGRGKAARNWE
AFDHIVATLDRLENDETLLVQSGKPVAVLRTHEWAPRVLIANSNLVPHWANWETFDKLDQ
AGLMMYGQMTAGSWIYIGTQGILQGTYETFAGAAQKHFGGSLKGTITVTAGLGGMGGAQP
LAVKLAGGVSITIEIDPTRIRKRLETRYLDEVADNLQDAIARAEGYKAQGVARSIGVQGN
AAELVPQLVEMNWTPDLLTDQTSAHDPMWGYIPPVNADEDAGKLRSEHAEEYRQRAYAAM
AAHVRAMLELQKRGAVTFDYGNNLRQRAFEAGVEDAFSYPGFVPAFIRDSFCEGRGPFRW
VALSGDPQDIYATDKALLELFPEDERLQSWLTYAADQIAFQGLPARICWLGYKERDRAAK
LFNDMVKDGRVKAPIVIGRDHLDAGSVASPYRETEAMKDGSDAVSDWPLLNFGVGIASGA
SWMSFHHGGGVGLGFSQHSGLVIVADGTDEAAKKLSRALTNDPGMGVIRHADAGYDHALD
VARERGIDLPSLGIKDHA
Download sequence
Identical sequences Q9RZ02
NP_285475.1.55610 WP_010889411.1.45201 WP_010889411.1.61927 WP_010889411.1.86829 gi|15807820|ref|NP_285475.1| 243230.DR_A0151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]