SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15807985|ref|NP_285648.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15807985|ref|NP_285648.1|
Domain Number 1 Region: 470-650
Classification Level Classification E-value
Superfamily PHM/PNGase F 3.5e-51
Family Glycosyl-asparaginase 0.0017
Further Details:      
 
Domain Number 2 Region: 159-231
Classification Level Classification E-value
Superfamily PA domain 0.0000000128
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15807985|ref|NP_285648.1|
Sequence length 654
Comment N-glycosidase F [Deinococcus radiodurans R1]
Sequence
MRFTLSVLSLTSVLLLSGCGLLSTPSDPNALTVQTAQGNVNLSGKNVVVVSKDTRSPEGA
AIWAGDLSKLQGGPADVTYLLLPGGATATEIQARADELRTAVTSAGLSGVNVVVASAPPA
PDSALGKLLDQWGTDLRDVKTSWNGGSLQVIALGDSGIGKSFTGTVALDAVLYGNDACGD
KAPVNDVAGKAAVILRGTCGFTDKVKAATKRGAAAVLLINNDSPLGVIRGACDDTCKSAI
LALLPNKEGTQLVGALQSGKTARVEVTNLRVLPSVLRISPDGTATDTGPIPYVFNSYLEE
DGVKPVDPFSSVRKEGEYLSWETALKTRLQNEDKSGKVTVVPVFKSQLAKDPSWRKEMIY
ADVTLPANFAQFDTLELDRALACDAARKSACPPWDYETNLYICDPLDLTKCNQELARDIT
PYWNSGRWVTDISPLLAVLREKAVNGKVRLAYWTVQPYKVTMNLRFQNKGNALIPVWAAP
LKFGGAFGDGAYNTRQAPVTFERPAWAKKVEFSTLVTGHGFNDSKSCAEFCNTVHHVTVN
GNDFTLSSPVTDNPLGCFEQVKDGVVPNQSGTWVYGRNNWCPGQGVKLWNSDLSAAATGP
GPHTLTYKALVDGQDHLSKLEDGAERDASIHMTSWLVYYAERGAALPSKPNVKQ
Download sequence
Identical sequences Q9RYI7
NP_285648.1.55610 WP_010889584.1.45201 WP_010889584.1.61927 WP_010889584.1.86829 gi|15807985|ref|NP_285648.1| 243230.DR_A0325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]