SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15805335|ref|NP_294029.1| from Deinococcus radiodurans R1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15805335|ref|NP_294029.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 5.62e-56
Family Ribosomal protein S7 0.000000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15805335|ref|NP_294029.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Deinococcus radiodurans R1]
Sequence
MARRRRAEVRPVQPDLVYQDVLVSAMINRIMRDGKKNLASRIFYGACRLVQERTGQEPLK
VFKQAYDNVKPRVEVRSRRVGGSTYQVPVEVGPRRQQSLTLRWMISAVDGRPERTAIERL
AGEIMDAAQGRGGAIKKKDDVERMAEANRAYAHYRW
Download sequence
Identical sequences Q9RXK6
gi|15805335|ref|NP_294029.1| NP_294029.1.55610 WP_010886951.1.45201 WP_010886951.1.61927 WP_010886951.1.86829 243230.DR_0306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]