SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392390871|ref|YP_006427474.1| from Ornithobacterium rhinotracheale DSM 15997

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392390871|ref|YP_006427474.1|
Domain Number 1 Region: 12-222
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.46e-57
Family PP-loop ATPase 0.0000392
Further Details:      
 
Domain Number 2 Region: 338-421
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000225
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392390871|ref|YP_006427474.1|
Sequence length 429
Comment tRNA(Ile)-lysidine synthetase [Ornithobacterium rhinotracheale DSM 15997]
Sequence
MGLVSDLDTFFNKKILVATSGGADSMVLLHLLHSHDIKVAAAHMNFNLRPKDCDKDQALV
KSFCKEYGIDFFTKSVDTKSFKKENKLSTQMAARELRYAWFRKIIEKQHFDCLATAHHLD
DNIETLIINLLRGSGIEGVAGMEIFNNGIWRPLLKTTKKQILEYAIAHNIPWREDKSNAE
NDYLRNHLRNVVLPELEEKCPEYRFGFEKSINFLQQDEMIIDNHIQALKDKLFSPNTDNS
IFIKIKELSELIPLDTYLFHLFKTYGFTAPQEIKKLIYAENSAEIANENYRLIKDRKHLI
LTKNEKIDFDAIYFLALNEEIHKPFSWKFTLDQNKNSQNLITFDADKVSFPLKLRKPQNG
DFFYPAGMNGKKKLSKFFKDLKLNKLQKEKTWVLTTANDEIMWVVGMRQDQRFTINKNTE
LCLNLQKLD
Download sequence
Identical sequences I4A146
gi|392390871|ref|YP_006427474.1| WP_014791242.1.65567 WP_014791242.1.68898 WP_014791242.1.95647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]