SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392391522|ref|YP_006428125.1| from Ornithobacterium rhinotracheale DSM 15997

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392391522|ref|YP_006428125.1|
Domain Number 1 Region: 215-410
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.59e-75
Family B3/B4 domain of PheRS, PheT 0.00000482
Further Details:      
 
Domain Number 2 Region: 44-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.15e-38
Family Myf domain 0.0056
Further Details:      
 
Domain Number 3 Region: 481-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.54e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0011
Further Details:      
 
Domain Number 4 Region: 710-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.7e-29
Family Anticodon-binding domain of PheRS 0.00071
Further Details:      
 
Domain Number 5 Region: 420-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000916
Family Domains B1 and B5 of PheRS-beta, PheT 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392391522|ref|YP_006428125.1|
Sequence length 809
Comment phenylalanyl-tRNA synthetase subunit beta [Ornithobacterium rhinotracheale DSM 15997]
Sequence
MKISHQLLSDFLKTDLNVEKVSAILTDTGLEVEGVEKTGVAKEDLEGFVVGKVLTCEQHP
NADKLKVTTVDLGNGNIQQIVCGAPNIAAGQNVPVATVGTVIKDDKGNSFTIKKAKLRGE
ESNGMICSQKELRISEDNSGIWVMDESLVAGTPLSEIIEESVDYVYEIGLTANRADAMSH
FGVARDAYAAMKSKKLNASFEQPNTELEISSKEKSPIEVKVEDAELCPRYAGIYIKGVKV
APSPQWLQQRLKAIGLSPKNNLVDATNYVLHGLGQPMHAFDADKIAGNTIIVKKATEGEK
FTTLDEVERTLSGDDLMICNANEPMCIAGVMGGKDSAVSETTQNIFLESAYFNPVSVRKT
AKSQTINSDSSFRFERGIDPNYCVKALHFAVKLIQEIAGGEVVGQIIDVYPTPIEGFDVL
LQYRNVERILGERLHREKIKEILELLDIEIISETDGTLELKVPAYRVDVQREIDVIEDIL
RIYGYNNIQINEKVSSSIVAGEGFLDHKVSEGISDLLITHGFNEAMNLSMYKKEYNDWLG
FSEKNSVTLINSLSQDVSTMRRSLLPSLLSNLDYNIKRRNSNIKLFEFGKSYRVENGKYI
ETPHLALAVTGDVAGENWHEKSRSVSFFYLKGVVEQILEKFKAQNTKGAELKKDYFTYAL
NYLLNEESLVYVAEVNKDLLKKFDIDQPVFYAEFGMEAFYKNYEENKGMKFKSLPKFPSV
RRDLALLLNTDTSYEAVKECVEACDTTHIKDVNLFDVYQGDKLPEGKKSYAISLQLQDEE
KTMNDKQIDAIMKKVIKVLQDKLNAELRN
Download sequence
Identical sequences I4A2Z7
gi|392391522|ref|YP_006428125.1| WP_014791834.1.65567 WP_014791834.1.68898 WP_014791834.1.95647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]