SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392391118|ref|YP_006427721.1| from Ornithobacterium rhinotracheale DSM 15997

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392391118|ref|YP_006427721.1|
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily TrpR-like 0.0000000000000045
Family SPO1678-like 0.031
Further Details:      
 
Weak hits

Sequence:  gi|392391118|ref|YP_006427721.1|
Domain Number - Region: 71-102
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0366
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392391118|ref|YP_006427721.1|
Sequence length 116
Comment transposase [Ornithobacterium rhinotracheale DSM 15997]
Sequence
MVKKQTKSEKLIKEVRRNTRQVYNAEQKILIVMEGLRAELSVAELCRKYGISEATYYKWS
KEFIEAGKKRLSGNETREATSEEVKDLRRENTVLKESLADLVIRYDIVKKSLNLLD
Download sequence
Identical sequences I3ZXB6
gi|392389541|ref|YP_006426144.1| gi|392389767|ref|YP_006426370.1| gi|392391103|ref|YP_006427706.1| gi|392391118|ref|YP_006427721.1| gi|392391369|ref|YP_006427972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]