SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DDB0216190|DDB_G0293524 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0216190|DDB_G0293524
Domain Number 1 Region: 867-1044
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.73e-62
Family Polyphosphate kinase C-terminal domain 0.0000378
Further Details:      
 
Domain Number 2 Region: 476-675
Classification Level Classification E-value
Superfamily PHP14-like 2.35e-56
Family PPK middle domain-like 0.00037
Further Details:      
 
Domain Number 3 Region: 689-861
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.66e-41
Family Polyphosphate kinase C-terminal domain 0.0000836
Further Details:      
 
Domain Number 4 Region: 374-473
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 6.28e-21
Family PPK N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0216190|DDB_G0293524
Sequence length 1053
Comment |Protein|gene: ppk1 on chromosome: 6 position 3029753 to 3032914
Sequence
MITNSKMENKILDEFDEEELNKLKINSNNKESTTTTTSTTTTTTTTTSTSGEESDDEHTG
SSSSTAAMELHRYKISQECPVDFEDDYDEESSSFDEEDEDSAAESNGGNGKLIPNPNDKK
KKRSSKSSSKSSKSKSKSKNKETTANPVQNCQLMESGTLFSPTEFVKSSTVNPSKSPVQP
IKLSSMLGLSELGTSNVLTVQNPQPISEPLKNDISSGSSSSSSSNNNNSNSNSNGNCNSD
STKSKFTSLNSWDAPPLANVLPDPSYCQDIVDSENNFIVPSVKHTILDVDNLFNNLIQNT
NNNNNNDFKSSTMIGKPFSSGGDGSTSPLISGLSSSSIIPNGNGSLAEQQQQQQQSIPES
EIPIDIKVLQLSGSRMFFNRELSELIYFYRILYEAYNPTYPILERVRFIAITSQNLDMYF
CKRALKLRLGYISTRKTLKPEEHYINMVLNTTRNLINEIYNIYMNILAPELSNNNVFIIK
YSDLTEPEKIQLRGFFLQHVFPLMTPLVVDAGHPFPNLSNLSLNIAVLLKHDEDTTRFVR
IKVPQRIPRFVHIKQRSNYSIIPMEEIILANLDTLFPNTKILTKSLFRVSRHNDLKLSGE
DQANDLLELIKTELHKRKFAPMVRLEVSHNMPAEILDMLKTQLALDAYDVYVINGPLGLQ
DLFELCKLNLPHLKFQPWVPHIPSRLVNLAKYPSEDVFSVIRKGELLVNLPYLSFNSSVQ
FFIESAVKDPKVLAIKIAIYRTNSNSQLIRALCEAASHKEVMVLVDLKASGDEEQNTKFA
RLLEQAGCHVSYGLVGLKTHAKIAMVVREEENGLREYLNISTGNYNASTSDVYADICLFS
CDPDLGEDMCNLFNYLTGYSRVSSFKKLLIAPMNMRSTLIQLIDNEAKNAREGKDATINA
VMNGLDDKRLVNALYQASIAGVKITLVVRGRCRILPGIKGISENIKVISILGRFLEHSRI
YCFHNNGKPKAYIASADWLHRNLKRRVEVMVPVDDANNIKQLYEIINVYCNDSNAWEMLS
DGRYKKRSSPIDEDSQTQFMNQTNQKHPVIWSK
Download sequence
Identical sequences Q54BM7
DDB0216190|DDB_G0293524 XP_629002.1.73096 44689.DDB_0216190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]