SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DDB0306124|DDB_G0277039 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0306124|DDB_G0277039
Domain Number 1 Region: 49-201,253-329
Classification Level Classification E-value
Superfamily Hsp33 domain 6.38e-34
Family Hsp33 domain 0.0019
Further Details:      
 
Domain Number 2 Region: 322-379
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.000000000288
Family HSP33 redox switch-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0306124|DDB_G0277039
Sequence length 419
Comment |Protein|gene: DDB_G0277039 on chromosome: 2 position 7313618 to 7315046
Sequence
MIRLFSKSTFFNGINFTKSISSPSVRYISNNSPTSESPKILEYKRTRVQVINAHNEKFKF
SFINLTKAANFSKTKHNLSISDAQLLGKLMSGVSMCASFLSDEERISAQIISDINPTHIY
AEAIHVGEVRGFLINGDTPRLETPDQVINRKGIFQFSKILYGHLKPIQSVVAVEEKDLTI
TKEFQHYFDQSEQIPSFIQLETRLKSNNNNSKSDNNNIVINDEIQQQIQIQEQQGQGQGQ
GQGQQIINSNNDVIDNDQLEFNGGILIQTLPSTTDEELVQLKNNIEKHSIADLFLKEKKS
IKEILSILTNNDPSVEIISTIFVDFYCRCTLKTFKDKILTLGINEIKHLEEHNHNELKCI
YCNRYHYLKDTDFKEMINHLEQDKEQKLKVLKEMEQEQEQEVQQQNNHTEKINDETKKE
Download sequence
Identical sequences Q550Q8
DDB0306124|DDB_G0277039 44689.DDBDRAFT_0217875 XP_642874.2.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]