SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DDB0308739|DDB_G0279747 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0308739|DDB_G0279747
Domain Number 1 Region: 28-102
Classification Level Classification E-value
Superfamily PGBD-like 0.00000011
Family Peptidoglycan binding domain, PGBD 0.038
Further Details:      
 
Domain Number 2 Region: 171-264
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.00000235
Family L,D-transpeptidase catalytic domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DDB0308739|DDB_G0279747
Sequence length 289
Comment |Protein|gene: DDB_G0279747 on chromosome: 3 position 2498789 to 2499747
Sequence
MKLIFSLVLIVLYTINIVLSSQQTYPCPFYRSLSLTNPPMNGDDIYILQSLLTRTTGLEN
LSLTSNFDQDTQMALAKFQSLNNVGTTSGTLDVNTANLILELNSEDGYVDNGQIPSGFLY
KVHVPVYKNRSIETIATLYDSNLNVLLTFPVRTHGQNDNVTGLAENEFCEDGSTPTGLMT
FDLNSPEPDPISFGPYPINRAVQGITGNAAIVISNIRDGILMHTGEWPDWTPSQPMPNSH
GCVHGHPSDIDQVQTILSTQLNVAIRQNTYGAMPYTHQPQGILSIELID
Download sequence
Identical sequences Q54WD2
XP_641526.1.73096 DDB0308739|DDB_G0279747 44689.DDBDRAFT_0206008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]