SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DDB0306518|DDB_G0268060 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0306518|DDB_G0268060
Domain Number 1 Region: 572-694
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DDB0306518|DDB_G0268060
Sequence length 814
Comment |Protein|gene: DDB_G0268060 on chromosome: 1 position 1380972 to 1383578
Sequence
MGDHLKNTREWIRHSSNKDDGNNAEKTHFFGHHEEEDHEHMLFTKEELTNPKELAKAMKV
KIPLYVPIFNWIKSYSKEDLIGDILSSITVATMLVPQGLAYAVLAGLPAIYGLYSGWLPL
VIYSFMGGCKQLAVGPEALLSVLLGSILGGYTTPPEDMTLNDYLVSIALTLALLVGIVSF
LFGICQFGFLGGILSRWVLSGFINAVALIIAISQLDSLLGVRTGGGGHTSDTTHGSTSTS
ISGSTISSMSEVLTETSTHHPGPYEKFWTAITNLQDSDKTTVILSAGCVVFLVGMRFFKQ
FLVKKMGWKNAKYIPEILLTVILTCVITAVFGLDRECVNTSDHDENKCVEQGSGVSVLRY
VKGGFPTVGFPSFQANTIQELLPQAFLIVIVGFVEATAVSKGLATKHNYQINSNRELVAF
GVANILGSIFGSYPVFSSIPRTSIQDMAGSRTCLSGFITSCLLLITCLFLTRLFYYLPYC
AMASIIFVAAFGLIEVHEAMFLWKTRSWGDLIQFSIALLATFIFEVEVGILISVGMCIFL
VLKHSSSPHVYSVLGRVPGTNRFKDVAKFPEAEPIEGILLVRIDEVLYFANIGQFKQLLS
EIERMMDRSTNVTGSGSTPLQSIIINVVNIPVMDASALLTIEEMVTAYHKRNVKVAFVQM
SEKIKESFKQSGLYDIVTPQFIFDSNYEAVSFLEQSINYSNNNDSRQVNLNMPQSDQSYD
DLNNNEVGGFDQPSSSSSSRFNNQNFLNKNNDNNNNNNNNNNDNNINDDDYQNSYNNNNN
NGGGAILSDGLKLEDYSEPESDEFIQSSNQKSKK
Download sequence
Identical sequences Q55FK8
44689.DDBDRAFT_0189750 DDB0306518|DDB_G0268060 XP_647525.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]