SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DDB0307598|DDB_G0276663 from Dictyostelium discoideum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DDB0307598|DDB_G0276663
Domain Number 1 Region: 725-755,798-875
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000147
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DDB0307598|DDB_G0276663
Sequence length 944
Comment |Protein|gene: DDB_G0276663 on chromosome: 2 position 7094813 to 7097853
Sequence
MTRYKQLGDDKQDDENQQTNNNNLNEENNLNNNNSNNNNNSNNNNIDNNNNEDNHNEEGR
ILNNSNTNIQRPQNILTSVRSPELYYLPPKKISLPGDSSPSTLLHQSLNSNGAGGSNASS
NASSNIGSKSNTPMLISTNSPKLTNNSSSPINILTNSHSNLMNSSSDIYISSNNNSNGFP
PLSLDNHYQQQQQQPNNNKNNNNNDESITVEEMKAQHIKNKEDYDTINFMNTIKQIRTFK
FEKKHKKKLQRYLYNLVPIIDWLPKYNWKSDWKGDLISGITVGVMLIPQGMAYALVAKLP
PIYGLYSSILPVLAYCIFGTSKQLSMGPFAIISLLVSETVTGVVGAGNTDEVYHVSVAIL
LALVCGAMQMFLGLIRFGFVANFLSDPVRTGFTSGCALIIGSSQLKHIFGYGVEETNFLL
LLVIRYLKDIAKTNWWSFLLGIIGVVFLLGIKKLNARFKLKIPGPLLVVVVFTFFSFILK
LEQRAHIKVVGEIPSGFPSPSFPLVRYNQSLYSQNEGVDGLPLPPNTNWFSVLIQLIPGS
LVLTLVGFISSISIGSKFGEKYNYIVEPNQELFALGASDFFGAFFLSFPVGASLSRTAVN
AQNGAVSQVSSFICTVIIVISVFFLTPVVYFLPRAVLSSIVIVAIIDLVEYQMVFDLWKV
HRKDLLLFGISFLSTTILGILQGILIGAIASLLMIIYRSAYPPFAVLGRLPGTEIYKNIK
RVPKAETFKGVRIVRIDGSIYFANCMFIKKKLRHHEPFSLKSGDQNHGSQEDIISFMTDS
EAENAYIDDDEPIEVDIDGHKIIGAIIIDFSSVNDIDSTGIRMLKELVSDFRKRQLVIYF
ASVKGYVRDSMKRGGVVDHYGADHFFWTINDAVEHHLFLLRQSKRSKELSKSRSINNSSN
NVIFNKQIQNNSILTTTTTNIDNDFDDVVGNASGNIPLINLKKI
Download sequence
Identical sequences Q551C0
XP_643018.1.73096 44689.DDBDRAFT_0202939 DDB0307598|DDB_G0276663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]