SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0224806 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0224806
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 1.44e-58
Family CutC-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0224806   Gene: FBgn0197672   Transcript: FBtr0226314
Sequence length 260
Comment type=protein; loc=scaffold_12855:complement(3424089..3424871); ID=FBpp0224806; name=Dvir\GJ10389-PA; parent=FBgn0197672,FBtr0226314; dbxref=FlyBase:FBpp0224806,FlyBase_Annotation_IDs:GJ10389-PA,GB_protein:EDW59248,REFSEQ:XP_002056136,FlyMine:FBpp0224806; MD5=fe0fc545da0fe1ffaf8aa42b292550e6; length=260; release=r1.2; species=Dvir;
Sequence
MSAHDIKLEVCVDSIKSAFAAEEGGAARIELCAALQEGGLTPTTGTLKTLKELPFTLPIH
CMLRPRRGTDFVYSEEEMQAVQTDMDLLRTHGADGFVFGALTPERTIDVDKCRRVMERSC
GLPVTFHRAFDLTDPKLMHENVQLLKELGFKRVLSSGFRATAAEGVDSLAQLIAKHHRDI
IIMPGAGIKVANLEEILTFSRCQEFHASALDTASEDYSAPTTTRMECDVTMGKQDIDPYY
GTNVYVVRKMVAIASAMSCR
Download sequence
Identical sequences B4M6H2
FBpp0224806 XP_002056136.1.90633 7244.FBpp0224806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]