SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0230575 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0230575
Domain Number 1 Region: 35-102
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 7.19e-25
Family Delta-sleep-inducing peptide immunoreactive peptide 0.00043
Further Details:      
 
Weak hits

Sequence:  FBpp0230575
Domain Number - Region: 125-183
Classification Level Classification E-value
Superfamily CutC-like 0.0157
Family CutC-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0230575   Gene: FBgn0203343   Transcript: FBtr0232083
Sequence length 201
Comment type=protein; loc=scaffold_13246:complement(1655233..1655736,1657759..1657860); ID=FBpp0230575; name=Dvir\GJ16158-PA; parent=FBgn0203343,FBtr0232083; dbxref=FlyBase:FBpp0230575,FlyBase_Annotation_IDs:GJ16158-PA,GB_protein:EDW71265,REFSEQ:XP_002059207,FlyMine:FBpp0230575; MD5=7124ca55bf3d92ebea87d99c9802e22b; length=201; release=r1.2; species=Dvir;
Sequence
MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAKDLVKSHLMIAVREEVEVLKERISELM
DKISNLELENNILKSNMSPETLQQLQMQLQIAGSQQPAAVAAPPATPAIQAAPTATAAAV
TVAATPASAAATSPAASAAPTAATVIVANGGGVGAENGSSSSGSGVDAAIATASIVDAAQ
PAANGSSGIAAAAISTNGPMS
Download sequence
Identical sequences B4MDK4
XP_002059207.1.90633 FBpp0230575 7244.FBpp0230575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]