SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0236825 from Drosophila virilis 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0236825
Domain Number 1 Region: 434-563
Classification Level Classification E-value
Superfamily Plus3-like 8.76e-43
Family Plus3 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0236825   Gene: FBgn0209520   Transcript: FBtr0238333
Sequence length 778
Comment type=protein; loc=scaffold_12875:join(19294301..19294381,19294491..19295460,19295516..19296694,19296756..19296862); ID=FBpp0236825; name=Dvir\GJ22408-PA; parent=FBgn0209520,FBtr0238333; dbxref=FlyBase:FBpp0236825,FlyBase_Annotation_IDs:GJ22408-PA,GB_protein:EDW62096,REFSEQ:XP_002050903,FlyMine:FBpp0236825; MD5=aad21fbbd14403a209f6195c55d5c2b0; length=778; release=r1.2; species=Dvir;
Sequence
MGKRRTQSLIDSNSSDSDSDADTNLESDLLSLARKRKKPSNATKAPNSKSDSDSDWANNK
SSAPASKKKRPKKTNRDSSSSEENWDDDSQDEVAAPVEKRAEPEHKKPDIQSEQEEGEVS
DSDSDNEKSKSKSSSTSGSPSGSDSSSSSSSSSDSEFDDGYDDDLMGDEEDRKRLNGLSE
KERETEIFKRIEQRDIMRTRWEIERKLKLARRGEKNEKSKTKGERAKKKSKKDKRSKKSK
DLAPPVPAATTADIDTSKSGAPEARASAKSPSPIPSIREGPSTSGTGSSTTSSSAEKNAE
EQSSGNVADYFDHKERSKERKKNVEANKTDDKRSNAMAMLKAKREGKAKREEEEAKRQAE
RDRDDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDDEEKPAGKRSRSNSSKASSESE
DDEKATKSPVFITTREDLNKLRLSRFKMERFVNLPIFESTVVNCFVRISIGNNGQKPVYR
VAEIVGVVETGKIYTLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTETEFNKWVEICQQ
QHVPMPTIDLIEIKANDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERD
AAMLRGDYDIANDLGQQIDQLESRASELDKRRSHSLNLISYINDRNRKRNVQDAEKAIME
EARANKGMKISDPFTRRITQPRMGFKGTKKDEDESLAVPLPPPPPGKKKPNETSTSNAKP
ADGKDYSLYSLHDFDIDLDVPLPVNSANALPKPANKPTETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4LMY1
XP_002050903.1.90633 FBpp0236825 7244.FBpp0236825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]